BLASTX nr result
ID: Forsythia22_contig00015604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00015604 (360 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831602.1| PREDICTED: importin subunit alpha-1-like [Er... 61 3e-07 ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum... 59 1e-06 ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [So... 59 2e-06 ref|XP_009612538.1| PREDICTED: importin subunit alpha-1a-like [N... 57 5e-06 >ref|XP_012831602.1| PREDICTED: importin subunit alpha-1-like [Erythranthe guttatus] gi|848903398|ref|XP_012851486.1| PREDICTED: importin subunit alpha-1-like [Erythranthe guttatus] gi|604306980|gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Erythranthe guttata] gi|604343231|gb|EYU42202.1| hypothetical protein MIMGU_mgv1a004354mg [Erythranthe guttata] Length = 531 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 360 DDESAPPGEDASQQGFQFGGGDASVPSGGFSFN 262 DDE APPG+ A+QQGFQFGG D S+PSGGFSFN Sbjct: 499 DDEPAPPGDAAAQQGFQFGGSDVSLPSGGFSFN 531 >ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum] Length = 529 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 360 DDESAPPGEDASQQGFQFGGGDASVPSGGFSFN 262 DDE+ PPG DA+QQGFQFGGG+ SVPSGGFSFN Sbjct: 498 DDETMPPG-DAAQQGFQFGGGEVSVPSGGFSFN 529 >ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum] Length = 529 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 360 DDESAPPGEDASQQGFQFGGGDASVPSGGFSFN 262 DDE+ PPG DA QQGFQFGGG+ SVPSGGFSFN Sbjct: 498 DDETMPPG-DAPQQGFQFGGGEVSVPSGGFSFN 529 >ref|XP_009612538.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis] Length = 528 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 360 DDESAPPGEDASQQGFQFGGGDASVPSGGFSFN 262 DDE+ PPG DA QQGFQFGGG+ SVPSGGF+FN Sbjct: 497 DDETMPPG-DAPQQGFQFGGGNVSVPSGGFNFN 528