BLASTX nr result
ID: Forsythia22_contig00015216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00015216 (420 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 >ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067389|ref|XP_011080414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067391|ref|XP_011080415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] Length = 742 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = -1 Query: 234 SMIRKKLFLNPFL---HQNLIFTNLFSSVPHTSPLPGFTPNDLHAVEIQIKSLCEKPNTR 64 ++IRK L+P+L QN NL SS P+ + + L VE QI SLC+K N+ Sbjct: 4 TIIRKNFLLHPYLLFPSQNRNLINLLSSTPNLNTVCDSAAY-LDTVETQISSLCQKSNSS 62 Query: 63 TEFIKALSLFDDVVDMGLVPS 1 +F +A S+F VDMGL+PS Sbjct: 63 VQFREAFSIFQQSVDMGLIPS 83 >ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848706|ref|XP_012853630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848710|ref|XP_012853693.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848713|ref|XP_012853760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848716|ref|XP_012853815.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848720|ref|XP_012853859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848724|ref|XP_012853912.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] Length = 745 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 3/78 (3%) Frame = -1 Query: 225 RKKLFLNPFLHQN---LIFTNLFSSVPHTSPLPGFTPNDLHAVEIQIKSLCEKPNTRTEF 55 R FLNP H ++ T+ + PH + + + VE +I+SLC+KPN+ Sbjct: 9 RNNRFLNPSFHFRSGVILLTHFLTPAPHFNHFSTSANQESNIVETRIESLCQKPNSIVNL 68 Query: 54 IKALSLFDDVVDMGLVPS 1 KA+S F++ VD GLVPS Sbjct: 69 RKAVSFFEETVDTGLVPS 86