BLASTX nr result
ID: Forsythia22_contig00014860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00014860 (179 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223933.1| hypothetical protein PRUPE_ppa014266mg [Prun... 61 3e-07 gb|EYU17719.1| hypothetical protein MIMGU_mgv1a017254mg [Erythra... 58 3e-06 emb|CBI17183.3| unnamed protein product [Vitis vinifera] 57 6e-06 >ref|XP_007223933.1| hypothetical protein PRUPE_ppa014266mg [Prunus persica] gi|462420869|gb|EMJ25132.1| hypothetical protein PRUPE_ppa014266mg [Prunus persica] Length = 77 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 70 VLGWFFLATGSISFLGFLYAAVISKLLPPSDNSIIS 177 + GWFF+A+GS+ FLGFLYA V+SKLLPPSDN I+S Sbjct: 6 IWGWFFIASGSVFFLGFLYATVLSKLLPPSDNIILS 41 >gb|EYU17719.1| hypothetical protein MIMGU_mgv1a017254mg [Erythranthe guttata] Length = 86 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 76 GWFFLATGSISFLGFLYAAVISKLLPPSDNSII 174 GWFFL GS SF+ FLYAAV+SKLLPPSDNS+I Sbjct: 17 GWFFLIFGSFSFVFFLYAAVVSKLLPPSDNSVI 49 >emb|CBI17183.3| unnamed protein product [Vitis vinifera] Length = 161 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +1 Query: 76 GWFFLATGSISFLGFLYAAVISKLLPPSDNSIIS 177 GW FL GSI FLGFLYAAVISKLLPPS N IIS Sbjct: 92 GWIFLIFGSIFFLGFLYAAVISKLLPPSGNVIIS 125