BLASTX nr result
ID: Forsythia22_contig00014798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00014798 (502 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268531.1| PREDICTED: WAT1-related protein At3g45870 [V... 48 4e-07 emb|CBI29186.3| unnamed protein product [Vitis vinifera] 48 4e-07 >ref|XP_002268531.1| PREDICTED: WAT1-related protein At3g45870 [Vitis vinifera] Length = 393 Score = 47.8 bits (112), Expect(2) = 4e-07 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -2 Query: 462 VTWASHREKQAAMGILRHAGWPYEPLVNKDSSLS 361 VTWAS+RE+QAAMG++ HA EPL++KD+SL+ Sbjct: 338 VTWASYRERQAAMGVIPHAIRASEPLIHKDASLT 371 Score = 32.7 bits (73), Expect(2) = 4e-07 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 343 YQIGHIFSGPSTSILKILD 287 YQ GHIFSGPSTS+ K LD Sbjct: 375 YQRGHIFSGPSTSLPKGLD 393 >emb|CBI29186.3| unnamed protein product [Vitis vinifera] Length = 352 Score = 47.8 bits (112), Expect(2) = 4e-07 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -2 Query: 462 VTWASHREKQAAMGILRHAGWPYEPLVNKDSSLS 361 VTWAS+RE+QAAMG++ HA EPL++KD+SL+ Sbjct: 297 VTWASYRERQAAMGVIPHAIRASEPLIHKDASLT 330 Score = 32.7 bits (73), Expect(2) = 4e-07 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 343 YQIGHIFSGPSTSILKILD 287 YQ GHIFSGPSTS+ K LD Sbjct: 334 YQRGHIFSGPSTSLPKGLD 352