BLASTX nr result
ID: Forsythia22_contig00013940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013940 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010245876.1| PREDICTED: phosphopantothenate--cysteine lig... 67 5e-09 emb|CDP01169.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_009780692.1| PREDICTED: phosphopantothenate--cysteine lig... 65 2e-08 ref|XP_009588763.1| PREDICTED: phosphopantothenate--cysteine lig... 65 2e-08 ref|XP_011083404.1| PREDICTED: phosphopantothenate--cysteine lig... 63 9e-08 ref|XP_010320142.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009791333.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009791332.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009791331.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009791329.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009791328.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_009615045.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 gb|KDO43122.1| hypothetical protein CISIN_1g021381mg [Citrus sin... 61 3e-07 gb|KDO43119.1| hypothetical protein CISIN_1g021381mg [Citrus sin... 61 3e-07 gb|KDO43118.1| hypothetical protein CISIN_1g021381mg [Citrus sin... 61 3e-07 gb|KDO43116.1| hypothetical protein CISIN_1g021381mg [Citrus sin... 61 3e-07 gb|KDO43115.1| hypothetical protein CISIN_1g021381mg [Citrus sin... 61 3e-07 ref|XP_006491564.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_006360292.1| PREDICTED: phosphopantothenate--cysteine lig... 61 3e-07 ref|XP_006421256.1| hypothetical protein CICLE_v10005436mg [Citr... 61 3e-07 >ref|XP_010245876.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nelumbo nucifera] Length = 328 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/46 (65%), Positives = 40/46 (86%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 EEV+VV+ + +ITVHRD N+A ADVESPLIKL+V++HS YIK+ G+ Sbjct: 281 EEVVVVTSNERITVHRDSNEADADVESPLIKLLVEKHSAYIKETGT 326 >emb|CDP01169.1| unnamed protein product [Coffea canephora] Length = 278 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAG 94 +EVIVV++SG I V RDK Q GA+VESPL++L+VDRHS YIK+AG Sbjct: 233 DEVIVVAKSGNIVVRRDKAQPGAEVESPLVELLVDRHSAYIKEAG 277 >ref|XP_009780692.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana sylvestris] gi|698456775|ref|XP_009780693.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana sylvestris] gi|698456779|ref|XP_009780694.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana sylvestris] Length = 325 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ KI V RDK QAGADVE PLIKL+VDRHS YIK Sbjct: 280 EEVIVVTEQEKIAVRRDKTQAGADVEDPLIKLVVDRHSAYIK 321 >ref|XP_009588763.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697099958|ref|XP_009588772.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697099960|ref|XP_009588776.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697099962|ref|XP_009588782.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] Length = 325 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ KITV RDK QAGADVE+PLIKL+VDRH YIK Sbjct: 280 EEVIVVTEQEKITVRRDKTQAGADVENPLIKLVVDRHWSYIK 321 >ref|XP_011083404.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Sesamum indicum] gi|747072929|ref|XP_011083405.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Sesamum indicum] Length = 326 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYI 106 EEVIVV+++G IT+ RD AGADVE PL+KLIVDRHS YI Sbjct: 282 EEVIVVTKNGNITIRRDMTHAGADVEEPLVKLIVDRHSAYI 322 >ref|XP_010320142.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Solanum lycopersicum] Length = 327 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD +AGA+VESPL++L+VDRHS YIK Sbjct: 282 EEVIVVTEQEKVTVRRDSTRAGAEVESPLVELVVDRHSTYIK 323 >ref|XP_009791333.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X5 [Nicotiana sylvestris] Length = 332 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 287 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 328 >ref|XP_009791332.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X4 [Nicotiana sylvestris] Length = 333 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 288 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 329 >ref|XP_009791331.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X3 [Nicotiana sylvestris] Length = 348 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 303 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 344 >ref|XP_009791329.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X2 [Nicotiana sylvestris] gi|698489574|ref|XP_009791330.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X2 [Nicotiana sylvestris] Length = 360 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 315 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 356 >ref|XP_009791328.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X1 [Nicotiana sylvestris] Length = 367 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 322 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 363 >ref|XP_009615045.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697096161|ref|XP_009615048.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697096163|ref|XP_009615052.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] gi|697096165|ref|XP_009615057.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Nicotiana tomentosiformis] Length = 325 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIK 103 EEVIVV+ K+TV RD QAGA+VE PL++L+VDRHS YIK Sbjct: 280 EEVIVVTEQEKVTVRRDSTQAGAEVECPLVELVVDRHSAYIK 321 >gb|KDO43122.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] Length = 210 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 165 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 210 >gb|KDO43119.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] gi|641823736|gb|KDO43120.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] gi|641823737|gb|KDO43121.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] Length = 230 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 185 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 230 >gb|KDO43118.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] Length = 289 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 244 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 289 >gb|KDO43116.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] gi|641823733|gb|KDO43117.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] Length = 313 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 268 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 313 >gb|KDO43115.1| hypothetical protein CISIN_1g021381mg [Citrus sinensis] Length = 292 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 247 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 292 >ref|XP_006491564.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Citrus sinensis] Length = 313 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 268 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 313 >ref|XP_006360292.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Solanum tuberosum] Length = 318 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYI 106 EEVIVV+ KITV RD Q GADVE PLIKL+VDRHS YI Sbjct: 276 EEVIVVTEQEKITVRRDTTQPGADVEDPLIKLVVDRHSAYI 316 >ref|XP_006421256.1| hypothetical protein CICLE_v10005436mg [Citrus clementina] gi|557523129|gb|ESR34496.1| hypothetical protein CICLE_v10005436mg [Citrus clementina] Length = 289 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 228 EEVIVVSRSGKITVHRDKNQAGADVESPLIKLIVDRHSEYIKDAGS 91 E+V+VV+ +GKI V+RDK + +DVE PL KL+VDRHS YIKD+ + Sbjct: 244 EQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 289