BLASTX nr result
ID: Forsythia22_contig00011619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00011619 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093651.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 2e-31 ref|XP_011093650.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 2e-31 ref|XP_011093649.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 2e-31 ref|XP_011093648.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 2e-31 ref|XP_011083561.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 3e-31 ref|XP_011083560.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 140 3e-31 ref|XP_011074326.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 139 6e-31 ref|XP_011074325.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 139 6e-31 emb|CDP03242.1| unnamed protein product [Coffea canephora] 135 1e-29 gb|AHB32107.1| arginyl-tRNA synthetase-like protein [Camellia si... 135 1e-29 ref|XP_009774844.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 132 1e-28 ref|XP_009774840.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 132 1e-28 ref|XP_009595899.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 131 2e-28 ref|XP_009595898.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 131 2e-28 ref|XP_012835723.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 130 3e-28 ref|XP_012835724.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 130 3e-28 ref|XP_009776396.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 129 6e-28 ref|XP_009776395.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 129 6e-28 ref|XP_009623437.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 129 8e-28 ref|XP_009623436.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 129 8e-28 >ref|XP_011093651.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X4 [Sesamum indicum] Length = 589 Score = 140 bits (354), Expect = 2e-31 Identities = 66/72 (91%), Positives = 70/72 (97%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK+GT+EL HPDERVLGLHLLQF EIVEEACTNLLPN+LCEYLYNLSEDFTRFYTNCQ Sbjct: 494 ELKKIGTMELDHPDERVLGLHLLQFLEIVEEACTNLLPNILCEYLYNLSEDFTRFYTNCQ 553 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 554 VVGSAEETSRLL 565 >ref|XP_011093650.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 [Sesamum indicum] Length = 615 Score = 140 bits (354), Expect = 2e-31 Identities = 66/72 (91%), Positives = 70/72 (97%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK+GT+EL HPDERVLGLHLLQF EIVEEACTNLLPN+LCEYLYNLSEDFTRFYTNCQ Sbjct: 520 ELKKIGTMELDHPDERVLGLHLLQFLEIVEEACTNLLPNILCEYLYNLSEDFTRFYTNCQ 579 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 580 VVGSAEETSRLL 591 >ref|XP_011093649.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Sesamum indicum] Length = 628 Score = 140 bits (354), Expect = 2e-31 Identities = 66/72 (91%), Positives = 70/72 (97%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK+GT+EL HPDERVLGLHLLQF EIVEEACTNLLPN+LCEYLYNLSEDFTRFYTNCQ Sbjct: 533 ELKKIGTMELDHPDERVLGLHLLQFLEIVEEACTNLLPNILCEYLYNLSEDFTRFYTNCQ 592 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 593 VVGSAEETSRLL 604 >ref|XP_011093648.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Sesamum indicum] Length = 629 Score = 140 bits (354), Expect = 2e-31 Identities = 66/72 (91%), Positives = 70/72 (97%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK+GT+EL HPDERVLGLHLLQF EIVEEACTNLLPN+LCEYLYNLSEDFTRFYTNCQ Sbjct: 534 ELKKIGTMELDHPDERVLGLHLLQFLEIVEEACTNLLPNILCEYLYNLSEDFTRFYTNCQ 593 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 594 VVGSAEETSRLL 605 >ref|XP_011083561.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Sesamum indicum] Length = 590 Score = 140 bits (353), Expect = 3e-31 Identities = 66/72 (91%), Positives = 69/72 (95%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK GTL+L HPDER LGLHLLQFAE+VEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 495 ELKKTGTLDLVHPDERTLGLHLLQFAEVVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 555 VVGSAEETSRLL 566 >ref|XP_011083560.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Sesamum indicum] Length = 646 Score = 140 bits (353), Expect = 3e-31 Identities = 66/72 (91%), Positives = 69/72 (95%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK GTL+L HPDER LGLHLLQFAE+VEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 551 ELKKTGTLDLVHPDERTLGLHLLQFAEVVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 610 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 611 VVGSAEETSRLL 622 >ref|XP_011074326.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Sesamum indicum] Length = 590 Score = 139 bits (351), Expect = 6e-31 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK GT++L HPDER LGLHLLQFAE+VEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 495 ELKKTGTIDLVHPDERTLGLHLLQFAEVVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 555 VVGSAEETSRLL 566 >ref|XP_011074325.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Sesamum indicum] Length = 646 Score = 139 bits (351), Expect = 6e-31 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK GT++L HPDER LGLHLLQFAE+VEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 551 ELKKTGTIDLVHPDERTLGLHLLQFAEVVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 610 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 611 VVGSAEETSRLL 622 >emb|CDP03242.1| unnamed protein product [Coffea canephora] Length = 648 Score = 135 bits (340), Expect = 1e-29 Identities = 62/72 (86%), Positives = 69/72 (95%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKKVGT++LAHPDERVLGLHLLQF E+VEEACTN+LPN+LCEYLYNLSEDFT+FYTNCQ Sbjct: 553 ELKKVGTVDLAHPDERVLGLHLLQFPEVVEEACTNMLPNILCEYLYNLSEDFTKFYTNCQ 612 Query: 36 VVGSSEETSRLL 1 VVGS +E SRLL Sbjct: 613 VVGSPQEISRLL 624 >gb|AHB32107.1| arginyl-tRNA synthetase-like protein [Camellia sinensis] Length = 589 Score = 135 bits (339), Expect = 1e-29 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK GT+ LAHPDER LGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSE FTRFY+NCQ Sbjct: 494 ELKKTGTIVLAHPDERALGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEFFTRFYSNCQ 553 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 554 VVGSAEETSRLL 565 >ref|XP_009774844.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana sylvestris] Length = 590 Score = 132 bits (331), Expect = 1e-28 Identities = 63/72 (87%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKKVG + LAHPDER LGLHLLQFAEIVEEAC NLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 495 ELKKVGGIVLAHPDERALGLHLLQFAEIVEEACINLLPNLLCEYLYKLSEDFTKFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 555 VVGSAEETSRLL 566 >ref|XP_009774840.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Nicotiana sylvestris] Length = 651 Score = 132 bits (331), Expect = 1e-28 Identities = 63/72 (87%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKKVG + LAHPDER LGLHLLQFAEIVEEAC NLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 556 ELKKVGGIVLAHPDERALGLHLLQFAEIVEEACINLLPNLLCEYLYKLSEDFTKFYTNCQ 615 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 616 VVGSAEETSRLL 627 >ref|XP_009595899.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana tomentosiformis] Length = 590 Score = 131 bits (329), Expect = 2e-28 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKKVG + LAHPDER LGLHLLQFAEIVEEAC NLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 495 ELKKVGGIVLAHPDERALGLHLLQFAEIVEEACINLLPNLLCEYLYKLSEDFTKFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRL+ Sbjct: 555 VVGSAEETSRLM 566 >ref|XP_009595898.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Nicotiana tomentosiformis] Length = 651 Score = 131 bits (329), Expect = 2e-28 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKKVG + LAHPDER LGLHLLQFAEIVEEAC NLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 556 ELKKVGGIVLAHPDERALGLHLLQFAEIVEEACINLLPNLLCEYLYKLSEDFTKFYTNCQ 615 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRL+ Sbjct: 616 VVGSAEETSRLM 627 >ref|XP_012835723.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Erythranthe guttatus] Length = 650 Score = 130 bits (328), Expect = 3e-28 Identities = 63/72 (87%), Positives = 66/72 (91%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 +LK+ GTL LAH DER LGLHLLQFAEIVEE+ TNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 555 QLKRTGTLNLAHTDERTLGLHLLQFAEIVEESITNLLPNVLCEYLYNLSEDFTRFYTNCQ 614 Query: 36 VVGSSEETSRLL 1 VVGS EETSRLL Sbjct: 615 VVGSEEETSRLL 626 >ref|XP_012835724.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Erythranthe guttatus] gi|848870239|ref|XP_012835725.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Erythranthe guttatus] gi|848870241|ref|XP_012835726.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Erythranthe guttatus] gi|604334732|gb|EYU38804.1| hypothetical protein MIMGU_mgv1a003377mg [Erythranthe guttata] Length = 589 Score = 130 bits (328), Expect = 3e-28 Identities = 63/72 (87%), Positives = 66/72 (91%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 +LK+ GTL LAH DER LGLHLLQFAEIVEE+ TNLLPNVLCEYLYNLSEDFTRFYTNCQ Sbjct: 494 QLKRTGTLNLAHTDERTLGLHLLQFAEIVEESITNLLPNVLCEYLYNLSEDFTRFYTNCQ 553 Query: 36 VVGSSEETSRLL 1 VVGS EETSRLL Sbjct: 554 VVGSEEETSRLL 565 >ref|XP_009776396.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana sylvestris] gi|698577162|ref|XP_009776397.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana sylvestris] gi|698577165|ref|XP_009776398.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana sylvestris] Length = 590 Score = 129 bits (325), Expect = 6e-28 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK G ++LAH DER+LGLHLLQF EIVEEACTNLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 495 ELKKSGAMDLAHQDERMLGLHLLQFPEIVEEACTNLLPNLLCEYLYKLSEDFTKFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 555 VVGSAEETSRLL 566 >ref|XP_009776395.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Nicotiana sylvestris] Length = 649 Score = 129 bits (325), Expect = 6e-28 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK G ++LAH DER+LGLHLLQF EIVEEACTNLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 554 ELKKSGAMDLAHQDERMLGLHLLQFPEIVEEACTNLLPNLLCEYLYKLSEDFTKFYTNCQ 613 Query: 36 VVGSSEETSRLL 1 VVGS+EETSRLL Sbjct: 614 VVGSAEETSRLL 625 >ref|XP_009623437.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Nicotiana tomentosiformis] Length = 590 Score = 129 bits (324), Expect = 8e-28 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK G ++LAH DER+LGLHLLQF EIVEEACTNLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 495 ELKKSGAMDLAHQDERMLGLHLLQFPEIVEEACTNLLPNLLCEYLYKLSEDFTKFYTNCQ 554 Query: 36 VVGSSEETSRLL 1 VVGS EETSRLL Sbjct: 555 VVGSDEETSRLL 566 >ref|XP_009623436.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Nicotiana tomentosiformis] Length = 649 Score = 129 bits (324), Expect = 8e-28 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = -3 Query: 216 ELKKVGTLELAHPDERVLGLHLLQFAEIVEEACTNLLPNVLCEYLYNLSEDFTRFYTNCQ 37 ELKK G ++LAH DER+LGLHLLQF EIVEEACTNLLPN+LCEYLY LSEDFT+FYTNCQ Sbjct: 554 ELKKSGAMDLAHQDERMLGLHLLQFPEIVEEACTNLLPNLLCEYLYKLSEDFTKFYTNCQ 613 Query: 36 VVGSSEETSRLL 1 VVGS EETSRLL Sbjct: 614 VVGSDEETSRLL 625