BLASTX nr result
ID: Forsythia22_contig00010293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00010293 (453 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009762446.1| PREDICTED: arabinogalactan peptide 23-like [... 57 6e-06 >ref|XP_009762446.1| PREDICTED: arabinogalactan peptide 23-like [Nicotiana sylvestris] Length = 62 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -2 Query: 374 MEMKKIAFXXXXXXXXXXXXXXXAPS-EAPALAPTSDAIAALPTIGSFIGASILSFFAVY 198 MEMKKIA P APA APTSDA AALP +G+ +GA+ LSFFA Y Sbjct: 1 MEMKKIACVTLIVAGSISAAMAQLPPISAPAPAPTSDATAALPALGTLVGATFLSFFAYY 60 Query: 197 MH 192 MH Sbjct: 61 MH 62