BLASTX nr result
ID: Forsythia22_contig00009555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00009555 (626 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008802488.1| PREDICTED: ubiquinone biosynthesis protein C... 65 2e-08 gb|KHN07888.1| Ubiquinone biosynthesis protein COQ9, mitochondri... 63 1e-07 ref|XP_004307067.1| PREDICTED: ubiquinone biosynthesis protein C... 63 1e-07 ref|XP_004243698.1| PREDICTED: ubiquinone biosynthesis protein C... 63 1e-07 ref|XP_003542366.1| PREDICTED: ubiquinone biosynthesis protein C... 63 1e-07 ref|XP_012851168.1| PREDICTED: ubiquinone biosynthesis protein C... 62 3e-07 ref|XP_008231942.1| PREDICTED: ubiquinone biosynthesis protein C... 62 3e-07 gb|EYU25843.1| hypothetical protein MIMGU_mgv1a010912mg [Erythra... 62 3e-07 ref|XP_007211773.1| hypothetical protein PRUPE_ppa009664mg [Prun... 62 3e-07 ref|XP_008358352.1| PREDICTED: ubiquinone biosynthesis protein C... 61 4e-07 ref|XP_004144042.2| PREDICTED: ubiquinone biosynthesis protein C... 61 5e-07 ref|XP_009771857.1| PREDICTED: ubiquinone biosynthesis protein C... 61 5e-07 ref|XP_008450946.1| PREDICTED: ubiquinone biosynthesis protein C... 61 5e-07 ref|XP_010260199.1| PREDICTED: uncharacterized protein LOC104599... 60 7e-07 emb|CDP03057.1| unnamed protein product [Coffea canephora] 60 7e-07 ref|XP_006367435.1| PREDICTED: ubiquinone biosynthesis protein C... 60 7e-07 ref|XP_011039959.1| PREDICTED: ubiquinone biosynthesis protein C... 60 9e-07 ref|XP_008356845.1| PREDICTED: ubiquinone biosynthesis protein C... 60 9e-07 ref|XP_008375559.1| PREDICTED: ubiquinone biosynthesis protein C... 60 9e-07 ref|XP_006381599.1| hypothetical protein POPTR_0006s14200g [Popu... 60 9e-07 >ref|XP_008802488.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial isoform X2 [Phoenix dactylifera] Length = 236 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 507 YLADFLDQIRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +L F Q+R GW+++AMIAGARDVG+SPSIVGSFPRKEA Sbjct: 31 FLMSFCGQVRFGWSESAMIAGARDVGISPSIVGSFPRKEA 70 >gb|KHN07888.1| Ubiquinone biosynthesis protein COQ9, mitochondrial [Glycine soja] Length = 306 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +3 Query: 468 E*KYVNQLRFGLSYLADFLDQIRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 E ++ L+ LSY+ ++LGWT+AA++AGARDVG+SPSIVGSFPRKEA Sbjct: 94 EDQHTRVLQASLSYV------LKLGWTEAALVAGARDVGLSPSIVGSFPRKEA 140 >ref|XP_004307067.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Fragaria vesca subsp. vesca] Length = 288 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 IRLGW++AAMIAGARDVG+SPSIVGSFPRKEA Sbjct: 90 IRLGWSEAAMIAGARDVGVSPSIVGSFPRKEA 121 >ref|XP_004243698.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Solanum lycopersicum] Length = 309 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 IRLGWT+ AMIAGARDVG+SPSIVGSFPRKEA Sbjct: 112 IRLGWTETAMIAGARDVGVSPSIVGSFPRKEA 143 >ref|XP_003542366.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Glycine max] Length = 306 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +3 Query: 468 E*KYVNQLRFGLSYLADFLDQIRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 E ++ L+ LSY+ ++LGWT+AA++AGARDVG+SPSIVGSFPRKEA Sbjct: 94 EDQHTRVLQASLSYV------LKLGWTEAALVAGARDVGLSPSIVGSFPRKEA 140 >ref|XP_012851168.1| PREDICTED: ubiquinone biosynthesis protein COQ9-A, mitochondrial [Erythranthe guttatus] Length = 300 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 IRLGW+DAAMIAGA++VG+SPSIVGSFPRKEA Sbjct: 103 IRLGWSDAAMIAGAKEVGVSPSIVGSFPRKEA 134 >ref|XP_008231942.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Prunus mume] Length = 302 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKE 623 IRLGW++AAMIAGARDVG+SPSIVGSFPRKE Sbjct: 104 IRLGWSEAAMIAGARDVGLSPSIVGSFPRKE 134 >gb|EYU25843.1| hypothetical protein MIMGU_mgv1a010912mg [Erythranthe guttata] Length = 298 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 IRLGW+DAAMIAGA++VG+SPSIVGSFPRKEA Sbjct: 101 IRLGWSDAAMIAGAKEVGVSPSIVGSFPRKEA 132 >ref|XP_007211773.1| hypothetical protein PRUPE_ppa009664mg [Prunus persica] gi|462407638|gb|EMJ12972.1| hypothetical protein PRUPE_ppa009664mg [Prunus persica] Length = 283 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKE 623 IRLGW++AAMIAGARDVG+SPSIVGSFPRKE Sbjct: 104 IRLGWSEAAMIAGARDVGLSPSIVGSFPRKE 134 >ref|XP_008358352.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Malus domestica] Length = 302 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKE 623 IRLGW++AAMIAGARDVG+SPSIVGSFPRKE Sbjct: 104 IRLGWSEAAMIAGARDVGVSPSIVGSFPRKE 134 >ref|XP_004144042.2| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Cucumis sativus] gi|700211221|gb|KGN66317.1| hypothetical protein Csa_1G597150 [Cucumis sativus] Length = 311 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 ++LGWT+AAMIAGARD+GMSPSIVGSF RKEA Sbjct: 113 VKLGWTEAAMIAGARDIGMSPSIVGSFARKEA 144 >ref|XP_009771857.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Nicotiana sylvestris] Length = 310 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +RLGWT+ AMI+GARDVG+SPSIVGSFPRKEA Sbjct: 113 LRLGWTETAMISGARDVGVSPSIVGSFPRKEA 144 >ref|XP_008450946.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Cucumis melo] Length = 310 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 ++LGWT+AAMIAGARD+GMSPSIVGSF RKEA Sbjct: 113 VKLGWTEAAMIAGARDIGMSPSIVGSFARKEA 144 >ref|XP_010260199.1| PREDICTED: uncharacterized protein LOC104599387 [Nelumbo nucifera] gi|720013504|ref|XP_010260200.1| PREDICTED: uncharacterized protein LOC104599387 [Nelumbo nucifera] Length = 150 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +RLGWT+ AMI GARDVG+SPSI+GSFPRKEA Sbjct: 108 VRLGWTETAMIKGARDVGLSPSIIGSFPRKEA 139 >emb|CDP03057.1| unnamed protein product [Coffea canephora] Length = 312 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 IRLGWT+AA+IAGAR+VG+SPSIVGSFPRK+A Sbjct: 112 IRLGWTEAALIAGAREVGVSPSIVGSFPRKDA 143 >ref|XP_006367435.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Solanum tuberosum] Length = 304 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +RLGWT+ AMI GARDVG+SPSIVGSFPRKEA Sbjct: 107 LRLGWTETAMITGARDVGVSPSIVGSFPRKEA 138 >ref|XP_011039959.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Populus euphratica] Length = 313 Score = 60.1 bits (144), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +RLGW++ AMIAGARDVG+SPSIVGSFPRKEA Sbjct: 116 LRLGWSEEAMIAGARDVGVSPSIVGSFPRKEA 147 >ref|XP_008356845.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like [Malus domestica] gi|658042456|ref|XP_008356846.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like [Malus domestica] Length = 302 Score = 60.1 bits (144), Expect = 9e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKE 623 IRLGW++AAMIAGA+DVG+SPSIVGSFPRKE Sbjct: 104 IRLGWSEAAMIAGAKDVGVSPSIVGSFPRKE 134 >ref|XP_008375559.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Malus domestica] gi|657967736|ref|XP_008375560.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Malus domestica] Length = 302 Score = 60.1 bits (144), Expect = 9e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKE 623 IRLGW++AAMIAGA+DVG+SPSIVGSFPRKE Sbjct: 104 IRLGWSEAAMIAGAKDVGVSPSIVGSFPRKE 134 >ref|XP_006381599.1| hypothetical protein POPTR_0006s14200g [Populus trichocarpa] gi|550336306|gb|ERP59396.1| hypothetical protein POPTR_0006s14200g [Populus trichocarpa] Length = 313 Score = 60.1 bits (144), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 531 IRLGWTDAAMIAGARDVGMSPSIVGSFPRKEA 626 +RLGW++ AMIAGARDVG+SPSIVGSFPRKEA Sbjct: 116 LRLGWSEEAMIAGARDVGVSPSIVGSFPRKEA 147