BLASTX nr result
ID: Forsythia22_contig00008530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00008530 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37594.1| hypothetical protein MIMGU_mgv1a009172mg [Erythra... 58 2e-06 >gb|EYU37594.1| hypothetical protein MIMGU_mgv1a009172mg [Erythranthe guttata] Length = 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 164 CMTSASELFYNRRSRFGRSSDPLQLGPDLDSP 69 CMTSASELFY+RRSRFGR+SDP +G DLDSP Sbjct: 67 CMTSASELFYSRRSRFGRNSDPFGVGADLDSP 98