BLASTX nr result
ID: Forsythia22_contig00007855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00007855 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g... 60 7e-07 >ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g18375 [Sesamum indicum] Length = 669 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 109 MERSRSKRYYYDQDYDSETLHSRTKPRYSGPQIG 8 MERSRSKRYYYDQDY+SETLH+R+KPRY G Sbjct: 1 MERSRSKRYYYDQDYESETLHTRSKPRYGNNSHG 34