BLASTX nr result
ID: Forsythia22_contig00007540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00007540 (1571 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009800700.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 66 9e-08 ref|XP_010095719.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [... 65 2e-07 ref|XP_006574846.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 2e-06 ref|XP_010249254.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-06 ref|XP_010249252.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-06 gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sin... 61 2e-06 ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 61 2e-06 ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272... 61 2e-06 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 61 2e-06 ref|XP_006487562.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-06 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-06 ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phas... 61 2e-06 ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Popu... 61 2e-06 ref|XP_006368849.1| hypothetical protein POPTR_0001s12920g [Popu... 61 2e-06 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-06 ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272... 61 2e-06 ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272... 61 2e-06 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 61 2e-06 ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [S... 61 2e-06 ref|XP_011086895.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 3e-06 >ref|XP_009800700.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Nicotiana sylvestris] Length = 181 Score = 65.9 bits (159), Expect = 9e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 FERTVPALRGEDYGKTKMRYPDYTETDSGLQYK 1 FE TVPALRG+DYGKTKMRYPDY ET SGLQYK Sbjct: 15 FEHTVPALRGKDYGKTKMRYPDYNETQSGLQYK 47 >ref|XP_010095719.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] gi|587872798|gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] Length = 350 Score = 64.7 bits (156), Expect = 2e-07 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 120 RLTVISLFERTVPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +LT I L TVPA+RG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 178 KLTCI-LNNNTVPAIRGKDYGKTKMRYPDYTETESGLQYK 216 Score = 60.5 bits (145), Expect = 4e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PA+RG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 142 MPAIRGKDYGKTKMRYPDYTETESGLQYK 170 >ref|XP_006574846.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Glycine max] Length = 189 Score = 61.6 bits (148), Expect = 2e-06 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = -3 Query: 117 LTVISLFER--TVPALRGEDYGKTKMRYPDYTETDSGLQYK 1 LT ISL +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 71 LTGISLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYK 111 >ref|XP_010249254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Nelumbo nucifera] Length = 205 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 96 MPALRGKDYGKTKMRYPDYTETESGLQYK 124 >ref|XP_010249252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Nelumbo nucifera] Length = 258 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 96 MPALRGKDYGKTKMRYPDYTETESGLQYK 124 >gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sinensis] Length = 267 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 105 MPALRGKDYGKTKMRYPDYTETESGLQYK 133 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|670358760|ref|XP_008666916.1| PREDICTED: uncharacterized protein LOC100272703 isoform X1 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 69 MPALRGKDYGKTKMRYPDYTETESGLQYK 97 >ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|670358764|ref|XP_008666926.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|194696764|gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 69 MPALRGKDYGKTKMRYPDYTETESGLQYK 97 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 80 MPALRGKDYGKTKMRYPDYTETESGLQYK 108 >ref|XP_006487562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X2 [Citrus sinensis] Length = 226 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 105 MPALRGKDYGKTKMRYPDYTETESGLQYK 133 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 105 MPALRGKDYGKTKMRYPDYTETESGLQYK 133 >ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] gi|561012330|gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] Length = 274 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 112 MPALRGKDYGKTKMRYPDYTETESGLQYK 140 >ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347126|gb|EEE82687.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 245 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 83 MPALRGKDYGKTKMRYPDYTETESGLQYK 111 >ref|XP_006368849.1| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347125|gb|ERP65418.1| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 178 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 83 MPALRGKDYGKTKMRYPDYTETESGLQYK 111 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Setaria italica] Length = 214 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 51 MPALRGKDYGKTKMRYPDYTETESGLQYK 79 >ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272703 isoform X4 [Zea mays] gi|414870317|tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 35 MPALRGKDYGKTKMRYPDYTETESGLQYK 63 >ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272703 isoform X3 [Zea mays] gi|414870315|tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 51 MPALRGKDYGKTKMRYPDYTETESGLQYK 79 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] gi|734355035|gb|KHN13920.1| Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Glycine soja] Length = 241 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 79 MPALRGKDYGKTKMRYPDYTETESGLQYK 107 >ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] gi|241941927|gb|EES15072.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] Length = 207 Score = 61.2 bits (147), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 45 MPALRGKDYGKTKMRYPDYTETESGLQYK 73 >ref|XP_011086895.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Sesamum indicum] Length = 257 Score = 60.8 bits (146), Expect = 3e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 87 VPALRGEDYGKTKMRYPDYTETDSGLQYK 1 +PALRG+DYGKTKMRYPDYTET+SGLQYK Sbjct: 92 MPALRGKDYGKTKMRYPDYTETNSGLQYK 120