BLASTX nr result
ID: Forsythia22_contig00007044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00007044 (380 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097585.1| PREDICTED: uncharacterized protein LOC105176... 64 3e-08 >ref|XP_011097585.1| PREDICTED: uncharacterized protein LOC105176469 [Sesamum indicum] Length = 520 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 378 HVLGSDQIHENEISVIDIDYEGDESVDFNENDAQRLLSRDMIFSD 244 H S+Q+H E SVIDIDYEGDE+ +FNEND QRLLSR++ FSD Sbjct: 474 HGSESNQLHGKERSVIDIDYEGDETAEFNENDKQRLLSRELTFSD 518