BLASTX nr result
ID: Forsythia22_contig00006706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00006706 (2127 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096055.1| hypothetical protein L484_008711 [Morus nota... 69 1e-08 ref|XP_010096057.1| hypothetical protein L484_008713 [Morus nota... 61 4e-06 >ref|XP_010096055.1| hypothetical protein L484_008711 [Morus notabilis] gi|587873685|gb|EXB62861.1| hypothetical protein L484_008711 [Morus notabilis] Length = 160 Score = 69.3 bits (168), Expect = 1e-08 Identities = 32/83 (38%), Positives = 47/83 (56%) Frame = -3 Query: 253 DFTKIRDKYRVSEGVRLIFSAMLDRPCDPSKGHVAVMSDAFECGMRLPLHKFFRAILWSY 74 D R K+ + GVRL + +D P P++G + + AFECG+RLP H FFR +L + Sbjct: 20 DIDDSRLKFSIPAGVRLRIPSAVDLPSQPNRGEICLHMLAFECGLRLPFHPFFRTVLAHF 79 Query: 73 NVCPYQMSLNF*TQSVGT*LLWQ 5 + P Q+SLN G +LW+ Sbjct: 80 GLAPTQLSLNVWMHMAGAVILWR 102 >ref|XP_010096057.1| hypothetical protein L484_008713 [Morus notabilis] gi|587873687|gb|EXB62863.1| hypothetical protein L484_008713 [Morus notabilis] Length = 242 Score = 60.8 bits (146), Expect = 4e-06 Identities = 29/83 (34%), Positives = 45/83 (54%) Frame = -3 Query: 253 DFTKIRDKYRVSEGVRLIFSAMLDRPCDPSKGHVAVMSDAFECGMRLPLHKFFRAILWSY 74 D +R K+ + GVRL ++ D P P G + + + AFE G+RLP H F R +L + Sbjct: 22 DMNNLRLKFNIPAGVRLRIPSVGDLPSCPKPGEIGLYTVAFEYGLRLPFHPFIRTVLAHF 81 Query: 73 NVCPYQMSLNF*TQSVGT*LLWQ 5 ++ P Q+S N G +LW+ Sbjct: 82 DLAPTQLSPNVWRHMAGAIILWR 104