BLASTX nr result
ID: Forsythia22_contig00006694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00006694 (465 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094422.1| PREDICTED: splicing factor U2af small subuni... 67 6e-09 >ref|XP_011094422.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum indicum] gi|747093253|ref|XP_011094423.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum indicum] gi|747093255|ref|XP_011094424.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum indicum] Length = 314 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 198 IEQWNKEKEQAEPAADNASNFNDNGSGFEHNENQSNDNNPQPSERGNVSYD 46 IEQWNKE+E+AE A D +S +DN G +HN +S+DNN PS++GN SYD Sbjct: 263 IEQWNKEREEAESARDYSSKSDDNSHGLKHNGGESSDNNLHPSDQGNGSYD 313