BLASTX nr result
ID: Forsythia22_contig00006642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00006642 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846076.2| PREDICTED: histone H2B [Amborella trichopoda] 125 1e-26 ref|XP_009140934.1| PREDICTED: histone H2B.3-like [Brassica rapa] 125 1e-26 emb|CDY15776.1| BnaC04g15480D [Brassica napus] 125 1e-26 emb|CDY72471.1| BnaCnng77830D [Brassica napus] 125 1e-26 emb|CDX77199.1| BnaC04g39940D [Brassica napus] 125 1e-26 emb|CDY71843.1| BnaA07g37520D [Brassica napus] 125 1e-26 ref|XP_006400898.1| hypothetical protein EUTSA_v10014927mg [Eutr... 125 1e-26 gb|ERN07750.1| hypothetical protein AMTR_s00012p00085300 [Ambore... 125 1e-26 ref|XP_006281264.1| hypothetical protein CARUB_v10027310mg [Caps... 125 1e-26 ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arab... 125 1e-26 ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arab... 125 1e-26 ref|XP_010535544.1| PREDICTED: histone H2B.11 [Tarenaya hassleri... 124 2e-26 ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192... 124 2e-26 ref|XP_009133865.1| PREDICTED: histone H2B.3 [Brassica rapa] gi|... 124 3e-26 emb|CDX95762.1| BnaC03g26430D [Brassica napus] 124 3e-26 gb|KDO72941.1| hypothetical protein CISIN_1g032181mg [Citrus sin... 124 3e-26 ref|XP_002533106.1| histone h2b, putative [Ricinus communis] gi|... 124 3e-26 ref|XP_006488268.1| PREDICTED: probable histone H2B.1-like [Citr... 124 3e-26 ref|XP_006424763.1| hypothetical protein CICLE_v10029263mg [Citr... 124 3e-26 gb|ERN07751.1| hypothetical protein AMTR_s00012p00085960 [Ambore... 124 3e-26 >ref|XP_006846076.2| PREDICTED: histone H2B [Amborella trichopoda] Length = 281 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 249 Query: 10 EIQ 2 EIQ Sbjct: 250 EIQ 252 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SKLARYNKKPTITSR Sbjct: 57 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR 116 Query: 10 EIQ 2 EIQ Sbjct: 117 EIQ 119 >ref|XP_009140934.1| PREDICTED: histone H2B.3-like [Brassica rapa] Length = 149 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 58 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 117 Query: 10 EIQ 2 EIQ Sbjct: 118 EIQ 120 >emb|CDY15776.1| BnaC04g15480D [Brassica napus] Length = 148 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 57 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 116 Query: 10 EIQ 2 EIQ Sbjct: 117 EIQ 119 >emb|CDY72471.1| BnaCnng77830D [Brassica napus] Length = 153 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 62 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 121 Query: 10 EIQ 2 EIQ Sbjct: 122 EIQ 124 >emb|CDX77199.1| BnaC04g39940D [Brassica napus] Length = 154 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 63 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 122 Query: 10 EIQ 2 EIQ Sbjct: 123 EIQ 125 >emb|CDY71843.1| BnaA07g37520D [Brassica napus] Length = 149 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 58 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 117 Query: 10 EIQ 2 EIQ Sbjct: 118 EIQ 120 >ref|XP_006400898.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum] gi|557101988|gb|ESQ42351.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum] Length = 150 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 59 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 118 Query: 10 EIQ 2 EIQ Sbjct: 119 EIQ 121 >gb|ERN07750.1| hypothetical protein AMTR_s00012p00085300 [Amborella trichopoda] Length = 139 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 48 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 107 Query: 10 EIQ 2 EIQ Sbjct: 108 EIQ 110 >ref|XP_006281264.1| hypothetical protein CARUB_v10027310mg [Capsella rubella] gi|482549968|gb|EOA14162.1| hypothetical protein CARUB_v10027310mg [Capsella rubella] Length = 150 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 59 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 118 Query: 10 EIQ 2 EIQ Sbjct: 119 EIQ 121 >ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arabidopsis lyrata subsp. lyrata] gi|297310493|gb|EFH40917.1| hypothetical protein ARALYDRAFT_496128, partial [Arabidopsis lyrata subsp. lyrata] Length = 145 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 56 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 115 Query: 10 EIQ 2 EIQ Sbjct: 116 EIQ 118 >ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] gi|297308453|gb|EFH39005.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 125 bits (313), Expect = 1e-26 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 46 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 105 Query: 10 EIQ 2 EIQ Sbjct: 106 EIQ 108 >ref|XP_010535544.1| PREDICTED: histone H2B.11 [Tarenaya hassleriana] Length = 150 Score = 124 bits (312), Expect = 2e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 59 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 118 Query: 10 EIQ 2 EIQ Sbjct: 119 EIQ 121 >ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192|sp|P40283.5|H2B11_ARATH RecName: Full=Histone H2B.11; AltName: Full=HTB4 gi|9757912|dbj|BAB08359.1| unnamed protein product [Arabidopsis thaliana] gi|16323079|gb|AAL15274.1| AT5g59910/mmn10_130 [Arabidopsis thaliana] gi|56236124|gb|AAV84518.1| At5g59910 [Arabidopsis thaliana] gi|98960893|gb|ABF58930.1| At5g59910 [Arabidopsis thaliana] gi|332009867|gb|AED97250.1| histone H2B [Arabidopsis thaliana] Length = 150 Score = 124 bits (312), Expect = 2e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 59 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 118 Query: 10 EIQ 2 EIQ Sbjct: 119 EIQ 121 >ref|XP_009133865.1| PREDICTED: histone H2B.3 [Brassica rapa] gi|674950111|emb|CDX83300.1| BnaA03g22060D [Brassica napus] Length = 155 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 +IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 64 NIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 123 Query: 10 EIQ 2 EIQ Sbjct: 124 EIQ 126 >emb|CDX95762.1| BnaC03g26430D [Brassica napus] Length = 151 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 +IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR Sbjct: 60 NIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 119 Query: 10 EIQ 2 EIQ Sbjct: 120 EIQ 122 >gb|KDO72941.1| hypothetical protein CISIN_1g032181mg [Citrus sinensis] Length = 128 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR Sbjct: 55 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 114 Query: 10 EIQ 2 EIQ Sbjct: 115 EIQ 117 >ref|XP_002533106.1| histone h2b, putative [Ricinus communis] gi|223527097|gb|EEF29278.1| histone h2b, putative [Ricinus communis] Length = 146 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR Sbjct: 57 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 116 Query: 10 EIQ 2 EIQ Sbjct: 117 EIQ 119 >ref|XP_006488268.1| PREDICTED: probable histone H2B.1-like [Citrus sinensis] gi|641854134|gb|KDO72942.1| hypothetical protein CISIN_1g032181mg [Citrus sinensis] Length = 146 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR Sbjct: 55 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 114 Query: 10 EIQ 2 EIQ Sbjct: 115 EIQ 117 >ref|XP_006424763.1| hypothetical protein CICLE_v10029263mg [Citrus clementina] gi|557526697|gb|ESR38003.1| hypothetical protein CICLE_v10029263mg [Citrus clementina] Length = 215 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR Sbjct: 124 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 183 Query: 10 EIQ 2 EIQ Sbjct: 184 EIQ 186 >gb|ERN07751.1| hypothetical protein AMTR_s00012p00085960 [Amborella trichopoda] Length = 148 Score = 124 bits (310), Expect = 3e-26 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 190 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR 11 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SKLARYNKKPTITSR Sbjct: 57 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR 116 Query: 10 EIQ 2 EIQ Sbjct: 117 EIQ 119