BLASTX nr result
ID: Forsythia22_contig00006588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00006588 (626 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN35373.1| Chitinase domain-containing protein 1 [Glycine soja] 63 1e-07 ref|XP_009393083.1| PREDICTED: chitinase domain-containing prote... 63 1e-07 ref|XP_006577345.1| PREDICTED: chitinase domain-containing prote... 63 1e-07 ref|XP_006577344.1| PREDICTED: chitinase domain-containing prote... 63 1e-07 ref|XP_007147295.1| hypothetical protein PHAVU_006G111900g [Phas... 63 1e-07 ref|XP_003521805.1| PREDICTED: chitinase domain-containing prote... 63 1e-07 ref|XP_007051585.1| Glycosyl hydrolase superfamily protein isofo... 63 1e-07 ref|XP_007051584.1| Glycosyl hydrolase superfamily protein isofo... 63 1e-07 ref|XP_004512315.1| PREDICTED: chitinase domain-containing prote... 63 1e-07 ref|XP_009134505.1| PREDICTED: chitinase domain-containing prote... 62 3e-07 ref|XP_010266473.1| PREDICTED: chitinase domain-containing prote... 61 4e-07 emb|CAN82499.1| hypothetical protein VITISV_004913 [Vitis vinifera] 61 4e-07 ref|XP_010913890.1| PREDICTED: chitinase domain-containing prote... 61 5e-07 ref|XP_010661902.1| PREDICTED: chitinase domain-containing prote... 61 5e-07 ref|XP_002320856.2| glycosyl hydrolase family 18 family protein ... 61 5e-07 ref|XP_010661903.1| PREDICTED: chitinase domain-containing prote... 61 5e-07 ref|XP_012835600.1| PREDICTED: chitinase domain-containing prote... 60 7e-07 gb|EYU38900.1| hypothetical protein MIMGU_mgv1a010899mg [Erythra... 60 7e-07 ref|XP_010095787.1| Uncharacterized protein L484_017594 [Morus n... 60 9e-07 ref|XP_010556593.1| PREDICTED: chitinase domain-containing prote... 60 9e-07 >gb|KHN35373.1| Chitinase domain-containing protein 1 [Glycine soja] Length = 356 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YG+LHDP MRN+ + Sbjct: 127 EMGYDGIVLESWSRWAAYGILHDPSMRNLAL 157 >ref|XP_009393083.1| PREDICTED: chitinase domain-containing protein 1 [Musa acuminata subsp. malaccensis] Length = 434 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNM 539 +MGYDGIVLESWSRWA YG+LHDP+MRNM Sbjct: 205 DMGYDGIVLESWSRWAAYGILHDPDMRNM 233 >ref|XP_006577345.1| PREDICTED: chitinase domain-containing protein 1 isoform X3 [Glycine max] Length = 414 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YG+LHDP MRN+ + Sbjct: 187 EMGYDGIVLESWSRWAAYGILHDPSMRNLAL 217 >ref|XP_006577344.1| PREDICTED: chitinase domain-containing protein 1 isoform X2 [Glycine max] Length = 416 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YG+LHDP MRN+ + Sbjct: 187 EMGYDGIVLESWSRWAAYGILHDPSMRNLAL 217 >ref|XP_007147295.1| hypothetical protein PHAVU_006G111900g [Phaseolus vulgaris] gi|561020518|gb|ESW19289.1| hypothetical protein PHAVU_006G111900g [Phaseolus vulgaris] Length = 425 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YG+LHDP MRN+ + Sbjct: 194 EMGYDGIVLESWSRWAAYGILHDPNMRNLAL 224 >ref|XP_003521805.1| PREDICTED: chitinase domain-containing protein 1 isoform X1 [Glycine max] Length = 418 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YG+LHDP MRN+ + Sbjct: 187 EMGYDGIVLESWSRWAAYGILHDPSMRNLAL 217 >ref|XP_007051585.1| Glycosyl hydrolase superfamily protein isoform 2 [Theobroma cacao] gi|508703846|gb|EOX95742.1| Glycosyl hydrolase superfamily protein isoform 2 [Theobroma cacao] Length = 442 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YGVLHDP+MRNM + Sbjct: 212 EMDYDGIVLESWSRWAAYGVLHDPDMRNMAL 242 >ref|XP_007051584.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao] gi|508703845|gb|EOX95741.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao] Length = 434 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YGVLHDP+MRNM + Sbjct: 204 EMDYDGIVLESWSRWAAYGVLHDPDMRNMAL 234 >ref|XP_004512315.1| PREDICTED: chitinase domain-containing protein 1 [Cicer arietinum] Length = 433 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDG+VLESWSRWA YG+LHDP MRN+ + Sbjct: 203 EMGYDGVVLESWSRWAAYGILHDPSMRNLAL 233 >ref|XP_009134505.1| PREDICTED: chitinase domain-containing protein 1 [Brassica rapa] Length = 423 Score = 61.6 bits (148), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMG+DGIVLESWSRWA YGVLHDP+MR M + Sbjct: 202 EMGFDGIVLESWSRWAAYGVLHDPDMRKMAL 232 >ref|XP_010266473.1| PREDICTED: chitinase domain-containing protein 1 [Nelumbo nucifera] Length = 434 Score = 61.2 bits (147), Expect = 4e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YGVLHDP+MR+ + Sbjct: 204 EMGYDGIVLESWSRWAAYGVLHDPDMRSKAL 234 >emb|CAN82499.1| hypothetical protein VITISV_004913 [Vitis vinifera] Length = 516 Score = 61.2 bits (147), Expect = 4e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YG+LHDP MRNM++ Sbjct: 226 EMDYDGIVLESWSRWAAYGILHDPVMRNMLL 256 >ref|XP_010913890.1| PREDICTED: chitinase domain-containing protein 1 [Elaeis guineensis] Length = 439 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YGVL+DP+MR+M + Sbjct: 210 EMGYDGIVLESWSRWAAYGVLNDPDMRSMAL 240 >ref|XP_010661902.1| PREDICTED: chitinase domain-containing protein 1 isoform X1 [Vitis vinifera] Length = 438 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YG+LHDP MRNM + Sbjct: 205 EMDYDGIVLESWSRWAAYGILHDPVMRNMAL 235 >ref|XP_002320856.2| glycosyl hydrolase family 18 family protein [Populus trichocarpa] gi|550323815|gb|EEE99171.2| glycosyl hydrolase family 18 family protein [Populus trichocarpa] Length = 433 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YG+LHDPEMRN + Sbjct: 204 EMEYDGIVLESWSRWAAYGILHDPEMRNKAL 234 >ref|XP_010661903.1| PREDICTED: chitinase domain-containing protein 1 isoform X2 [Vitis vinifera] gi|297745419|emb|CBI40499.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YG+LHDP MRNM + Sbjct: 205 EMDYDGIVLESWSRWAAYGILHDPVMRNMAL 235 >ref|XP_012835600.1| PREDICTED: chitinase domain-containing protein 1 [Erythranthe guttatus] Length = 476 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YGVLHDP+MR+ + Sbjct: 246 EMGYDGIVLESWSRWASYGVLHDPDMRDKAL 276 >gb|EYU38900.1| hypothetical protein MIMGU_mgv1a010899mg [Erythranthe guttata] Length = 298 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YGVLHDP+MR+ + Sbjct: 68 EMGYDGIVLESWSRWASYGVLHDPDMRDKAL 98 >ref|XP_010095787.1| Uncharacterized protein L484_017594 [Morus notabilis] gi|587872999|gb|EXB62207.1| Uncharacterized protein L484_017594 [Morus notabilis] Length = 881 Score = 60.1 bits (144), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EMGYDGIVLESWSRWA YGVLHDP RN + Sbjct: 205 EMGYDGIVLESWSRWAAYGVLHDPSTRNSAL 235 >ref|XP_010556593.1| PREDICTED: chitinase domain-containing protein 1 [Tarenaya hassleriana] Length = 432 Score = 60.1 bits (144), Expect = 9e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 625 EMGYDGIVLESWSRWAVYGVLHDPEMRNMVI 533 EM YDGIVLESWSRWA YGVLHDP+MR M + Sbjct: 202 EMEYDGIVLESWSRWAAYGVLHDPDMRTMAL 232