BLASTX nr result
ID: Forsythia22_contig00006157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00006157 (484 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010538966.1| PREDICTED: transmembrane protein 50 homolog ... 107 3e-21 ref|XP_011097572.1| PREDICTED: transmembrane protein 50 homolog ... 105 2e-20 ref|XP_010478964.1| PREDICTED: transmembrane protein 50 homolog ... 105 2e-20 emb|CDY47997.1| BnaA05g36340D [Brassica napus] 105 2e-20 ref|XP_009145110.1| PREDICTED: transmembrane protein 50A [Brassi... 105 2e-20 ref|XP_006305678.1| hypothetical protein CARUB_v10010396mg [Caps... 105 2e-20 ref|NP_564477.1| uncharacterized protein [Arabidopsis thaliana] ... 105 2e-20 ref|XP_009589362.1| PREDICTED: transmembrane protein 50 homolog ... 104 2e-20 gb|KFK21889.1| hypothetical protein AALP_AAs60089U000300 [Arabis... 104 2e-20 ref|XP_006364964.1| PREDICTED: transmembrane protein 50 homolog ... 104 2e-20 gb|KHG06674.1| Transmembrane 50A [Gossypium arboreum] 104 3e-20 ref|XP_010530183.1| PREDICTED: transmembrane protein 50 homolog ... 103 3e-20 ref|XP_011074884.1| PREDICTED: transmembrane protein 50 homolog ... 103 5e-20 ref|XP_010671732.1| PREDICTED: transmembrane protein 50 homolog ... 103 5e-20 ref|XP_006396015.1| hypothetical protein EUTSA_v10005115mg [Eutr... 103 5e-20 gb|EPS68809.1| hypothetical protein M569_05961 [Genlisea aurea] 103 5e-20 ref|XP_012853511.1| PREDICTED: transmembrane protein 50A-like [E... 103 6e-20 ref|XP_012467915.1| PREDICTED: transmembrane protein 50 homolog ... 103 6e-20 ref|XP_010064004.1| PREDICTED: transmembrane protein 50 homolog ... 103 6e-20 ref|XP_012452246.1| PREDICTED: transmembrane protein 50A isoform... 102 8e-20 >ref|XP_010538966.1| PREDICTED: transmembrane protein 50 homolog [Tarenaya hassleriana] Length = 135 Score = 107 bits (267), Expect = 3e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD+LV +GPSAWTGVAG+FQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSLVKTGPSAWTGVAGIFQCVFVLISGLMYWTSHSE 135 >ref|XP_011097572.1| PREDICTED: transmembrane protein 50 homolog [Sesamum indicum] Length = 135 Score = 105 bits (261), Expect = 2e-20 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLLIQDALV SGPSAWTGVAGV QCVFVLISGL+YW SHSE Sbjct: 80 FIAYVVSFVSLAASVGLLIQDALVESGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_010478964.1| PREDICTED: transmembrane protein 50 homolog [Camelina sativa] Length = 135 Score = 105 bits (261), Expect = 2e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSVVITGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135 >emb|CDY47997.1| BnaA05g36340D [Brassica napus] Length = 274 Score = 105 bits (261), Expect = 2e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 219 FIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 274 >ref|XP_009145110.1| PREDICTED: transmembrane protein 50A [Brassica rapa] gi|674960247|emb|CDX73382.1| BnaC05g27240D [Brassica napus] Length = 135 Score = 105 bits (261), Expect = 2e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135 >ref|XP_006305678.1| hypothetical protein CARUB_v10010396mg [Capsella rubella] gi|482574389|gb|EOA38576.1| hypothetical protein CARUB_v10010396mg [Capsella rubella] Length = 185 Score = 105 bits (261), Expect = 2e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 130 FIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 185 >ref|NP_564477.1| uncharacterized protein [Arabidopsis thaliana] gi|297846688|ref|XP_002891225.1| hypothetical protein ARALYDRAFT_314063 [Arabidopsis lyrata subsp. lyrata] gi|727437518|ref|XP_010500084.1| PREDICTED: transmembrane protein 50A-like [Camelina sativa] gi|727577385|ref|XP_010461366.1| PREDICTED: transmembrane protein 50A-like [Camelina sativa] gi|15292703|gb|AAK92720.1| unknown protein [Arabidopsis thaliana] gi|19310689|gb|AAL85075.1| unknown protein [Arabidopsis thaliana] gi|297337067|gb|EFH67484.1| hypothetical protein ARALYDRAFT_314063 [Arabidopsis lyrata subsp. lyrata] gi|332193763|gb|AEE31884.1| uncharacterized protein AT1G36980 [Arabidopsis thaliana] Length = 135 Score = 105 bits (261), Expect = 2e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135 >ref|XP_009589362.1| PREDICTED: transmembrane protein 50 homolog [Nicotiana tomentosiformis] gi|698542271|ref|XP_009766347.1| PREDICTED: transmembrane protein 50 homolog [Nicotiana sylvestris] Length = 136 Score = 104 bits (260), Expect = 2e-20 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLLIQDAL SGPSAWTGVAGV QCVFVLISGL+YWTSHSE Sbjct: 80 FIAYVVSFVSLAASVGLLIQDALGKSGPSAWTGVAGVLQCVFVLISGLIYWTSHSE 135 >gb|KFK21889.1| hypothetical protein AALP_AAs60089U000300 [Arabis alpina] Length = 135 Score = 104 bits (260), Expect = 2e-20 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYV++FVSLAASVGLLIQD++V +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVIAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135 >ref|XP_006364964.1| PREDICTED: transmembrane protein 50 homolog [Solanum tuberosum] Length = 136 Score = 104 bits (260), Expect = 2e-20 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLLIQDAL SGPSAWTGVAGV QCVFVLISGL+YWTSHSE Sbjct: 80 FIAYVVSFVSLAASVGLLIQDALGKSGPSAWTGVAGVLQCVFVLISGLIYWTSHSE 135 >gb|KHG06674.1| Transmembrane 50A [Gossypium arboreum] Length = 135 Score = 104 bits (259), Expect = 3e-20 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 F+AYVVSFVSLAASVGLLIQD+LVTSGPS WTG AGV QCVFVLISGL+YWTSHSE Sbjct: 80 FLAYVVSFVSLAASVGLLIQDSLVTSGPSLWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_010530183.1| PREDICTED: transmembrane protein 50 homolog [Tarenaya hassleriana] Length = 135 Score = 103 bits (258), Expect = 3e-20 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD+LV +GPS WTGVAG+FQCVFVLISGLMYWTSH E Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSLVKTGPSTWTGVAGIFQCVFVLISGLMYWTSHPE 135 >ref|XP_011074884.1| PREDICTED: transmembrane protein 50 homolog [Sesamum indicum] Length = 135 Score = 103 bits (257), Expect = 5e-20 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLLIQD LV SGPSAWTGVAGV QCVFVLISGL+YW SHSE Sbjct: 80 FIAYVVSFVSLAASVGLLIQDTLVKSGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_010671732.1| PREDICTED: transmembrane protein 50 homolog isoform X1 [Beta vulgaris subsp. vulgaris] gi|870869278|gb|KMT20023.1| hypothetical protein BVRB_1g000430 [Beta vulgaris subsp. vulgaris] Length = 135 Score = 103 bits (257), Expect = 5e-20 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 F+AYV+SFVSLAASVGLLIQDALV +GPSAWTG AGV QCVFVLISGL+YWTSHSE Sbjct: 80 FLAYVISFVSLAASVGLLIQDALVPTGPSAWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_006396015.1| hypothetical protein EUTSA_v10005115mg [Eutrema salsugineum] gi|557092654|gb|ESQ33301.1| hypothetical protein EUTSA_v10005115mg [Eutrema salsugineum] Length = 135 Score = 103 bits (257), Expect = 5e-20 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVV+FVSLAASVGLLIQD++ +GPS WTGVAGVFQCVFVLISGLMYWTSHSE Sbjct: 80 FIAYVVAFVSLAASVGLLIQDSVAKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135 >gb|EPS68809.1| hypothetical protein M569_05961 [Genlisea aurea] Length = 135 Score = 103 bits (257), Expect = 5e-20 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLL+QDA+V SGPSAWTGVAGV QCVFVLISGL+YW SHSE Sbjct: 80 FIAYVVSFVSLAASVGLLVQDAVVKSGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_012853511.1| PREDICTED: transmembrane protein 50A-like [Erythranthe guttatus] Length = 135 Score = 103 bits (256), Expect = 6e-20 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 FIAYVVSFVSLAASVGLLIQDALV SGPSAW GVAGV QCVFVLISGL+YW SHSE Sbjct: 80 FIAYVVSFVSLAASVGLLIQDALVESGPSAWAGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_012467915.1| PREDICTED: transmembrane protein 50 homolog isoform X2 [Gossypium raimondii] gi|823136320|ref|XP_012467916.1| PREDICTED: transmembrane protein 50 homolog isoform X2 [Gossypium raimondii] gi|823136322|ref|XP_012467917.1| PREDICTED: transmembrane protein 50 homolog isoform X2 [Gossypium raimondii] gi|823136324|ref|XP_012467918.1| PREDICTED: transmembrane protein 50 homolog isoform X2 [Gossypium raimondii] gi|763748832|gb|KJB16271.1| hypothetical protein B456_002G220400 [Gossypium raimondii] Length = 153 Score = 103 bits (256), Expect = 6e-20 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 F+AYVVSFVSLAASVGLL+QD+LVTSGPS WTG AGV QCVFVLISGL+YWTSHSE Sbjct: 98 FLAYVVSFVSLAASVGLLMQDSLVTSGPSLWTGTAGVLQCVFVLISGLIYWTSHSE 153 >ref|XP_010064004.1| PREDICTED: transmembrane protein 50 homolog [Eucalyptus grandis] Length = 135 Score = 103 bits (256), Expect = 6e-20 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 F AYVVSFVSLAASVGLLIQD+LVT+GPS WTGVAGV QCVFVLISGL+YWT+HSE Sbjct: 80 FFAYVVSFVSLAASVGLLIQDSLVTTGPSVWTGVAGVLQCVFVLISGLIYWTAHSE 135 >ref|XP_012452246.1| PREDICTED: transmembrane protein 50A isoform X2 [Gossypium raimondii] gi|763797436|gb|KJB64391.1| hypothetical protein B456_010G047100 [Gossypium raimondii] Length = 129 Score = 102 bits (255), Expect = 8e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 482 FIAYVVSFVSLAASVGLLIQDALVTSGPSAWTGVAGVFQCVFVLISGLMYWTSHSE 315 F+AYVVSFVSLAASVGLLIQD+LV SGPS WTG AGV QCVFVLISGL+YWTSHSE Sbjct: 74 FVAYVVSFVSLAASVGLLIQDSLVKSGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 129