BLASTX nr result
ID: Forsythia22_contig00005345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00005345 (1108 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231023.1| PREDICTED: thaumatin-like protein 1b [Solanu... 51 2e-09 ref|XP_009802491.1| PREDICTED: thaumatin-like protein 1b [Nicoti... 49 3e-09 ref|XP_009622123.1| PREDICTED: thaumatin-like protein 1b [Nicoti... 49 1e-08 emb|CAA06927.1| putative thaumatin-like protein precursor [Nicot... 49 1e-08 ref|XP_006359672.1| PREDICTED: thaumatin-like protein 1-like [So... 49 1e-08 ref|XP_011088583.1| PREDICTED: thaumatin-like protein 1b [Sesamu... 49 2e-08 ref|XP_012837168.1| PREDICTED: thaumatin-like protein 1b [Erythr... 45 3e-07 emb|CDO96934.1| unnamed protein product [Coffea canephora] 47 5e-07 >ref|XP_004231023.1| PREDICTED: thaumatin-like protein 1b [Solanum lycopersicum] Length = 276 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +1 Query: 799 AMLNPPGFILKSRKSITLRVPRFWSGRVWGHE*ISN 906 A +NP GF+LKS KS TL++PR WSGRVWG SN Sbjct: 47 APVNPTGFVLKSGKSKTLKMPRAWSGRVWGRTLCSN 82 Score = 39.7 bits (91), Expect(2) = 2e-09 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 711 LNAEVQSTTFKTVNKCRGTVWP 776 L +EVQSTTFK VN+CR TVWP Sbjct: 17 LFSEVQSTTFKIVNRCRHTVWP 38 >ref|XP_009802491.1| PREDICTED: thaumatin-like protein 1b [Nicotiana sylvestris] Length = 288 Score = 49.3 bits (116), Expect(2) = 3e-09 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +1 Query: 799 AMLNPPGFILKSRKSITLRVPRFWSGRVWGHE*ISN 906 A +NP GF LKS KS TL++PR WSGRVWG SN Sbjct: 50 APVNPTGFTLKSGKSKTLKMPRSWSGRVWGRTLCSN 85 Score = 40.8 bits (94), Expect(2) = 3e-09 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +3 Query: 711 LNAEVQSTTFKTVNKCRGTVWP 776 L +EVQSTTFK VNKCR TVWP Sbjct: 20 LLSEVQSTTFKIVNKCRHTVWP 41 >ref|XP_009622123.1| PREDICTED: thaumatin-like protein 1b [Nicotiana tomentosiformis] Length = 288 Score = 48.5 bits (114), Expect(2) = 1e-08 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +1 Query: 799 AMLNPPGFILKSRKSITLRVPRFWSGRVWGHE*ISN 906 A +NP GF LK+ KS TL++PR WSGRVWG SN Sbjct: 50 APINPTGFTLKTGKSRTLKMPRSWSGRVWGRTLCSN 85 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 711 LNAEVQSTTFKTVNKCRGTVWP 776 L ++VQSTTFK VNKCR TVWP Sbjct: 20 LFSDVQSTTFKIVNKCRHTVWP 41 >emb|CAA06927.1| putative thaumatin-like protein precursor [Nicotiana tabacum] Length = 258 Score = 48.5 bits (114), Expect(2) = 1e-08 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +1 Query: 799 AMLNPPGFILKSRKSITLRVPRFWSGRVWGHE*ISN 906 A +NP GF LK+ KS TL++PR WSGRVWG SN Sbjct: 50 APINPTGFTLKTGKSRTLKMPRSWSGRVWGRTLCSN 85 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 711 LNAEVQSTTFKTVNKCRGTVWP 776 L ++VQSTTFK VNKCR TVWP Sbjct: 20 LFSDVQSTTFKIVNKCRHTVWP 41 >ref|XP_006359672.1| PREDICTED: thaumatin-like protein 1-like [Solanum tuberosum] Length = 276 Score = 48.5 bits (114), Expect(2) = 1e-08 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +1 Query: 799 AMLNPPGFILKSRKSITLRVPRFWSGRVWGHE*ISN 906 A +NP GF+LKS KS TL++P WSGRVWG SN Sbjct: 47 APVNPTGFVLKSGKSKTLKMPTAWSGRVWGRTLCSN 82 Score = 39.3 bits (90), Expect(2) = 1e-08 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 717 AEVQSTTFKTVNKCRGTVWP 776 +EVQ+TTFK VNKCR TVWP Sbjct: 19 SEVQATTFKIVNKCRHTVWP 38 >ref|XP_011088583.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum] Length = 292 Score = 49.3 bits (116), Expect(2) = 2e-08 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +1 Query: 802 MLNPPGFILKSRKSITLRVPRFWSGRVW 885 +LNP GF+LKS KS TLRVPR WSGR+W Sbjct: 50 LLNPTGFVLKSGKSRTLRVPRSWSGRLW 77 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 720 EVQSTTFKTVNKCRGTVWP 776 EV STTFK VNKCR T+WP Sbjct: 22 EVDSTTFKIVNKCRRTIWP 40 >ref|XP_012837168.1| PREDICTED: thaumatin-like protein 1b [Erythranthe guttatus] gi|604333584|gb|EYU37935.1| hypothetical protein MIMGU_mgv1a011294mg [Erythranthe guttata] Length = 286 Score = 45.1 bits (105), Expect(2) = 3e-07 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +1 Query: 802 MLNPPGFILKSRKSITLRVPRFWSGRVW 885 +LNP GF+L+ KS TLRVP WSGRVW Sbjct: 49 LLNPTGFVLEPGKSRTLRVPNSWSGRVW 76 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 711 LNAEVQSTTFKTVNKCRGTVWP 776 L +EV++TTFK VNKCR T+WP Sbjct: 18 LFSEVETTTFKIVNKCRRTIWP 39 >emb|CDO96934.1| unnamed protein product [Coffea canephora] Length = 290 Score = 47.0 bits (110), Expect(2) = 5e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +1 Query: 805 LNPPGFILKSRKSITLRVPRFWSGRVWG 888 LN GFILKS KSITL VP WSGR+WG Sbjct: 57 LNSTGFILKSGKSITLSVPSSWSGRIWG 84 Score = 35.4 bits (80), Expect(2) = 5e-07 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 723 VQSTTFKTVNKCRGTVWP 776 VQST FK VNKCR T+WP Sbjct: 29 VQSTKFKIVNKCRHTIWP 46