BLASTX nr result
ID: Forsythia22_contig00004669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00004669 (984 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078167.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 64 1e-07 ref|XP_012857650.1| PREDICTED: extensin-like [Erythranthe guttatus] 62 6e-07 ref|XP_012833311.1| PREDICTED: leucine-rich repeat extensin-like... 62 6e-07 >ref|XP_011078167.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, testis-specific-like [Sesamum indicum] Length = 138 Score = 64.3 bits (155), Expect = 1e-07 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 430 YIYINGPPGNLYPVDPYYSGASRRFSLGL-PFFICTVLGLIAF 305 Y+Y+NGPPGNLYPV PYYSG +R FS+G+ PF I +L L+AF Sbjct: 96 YVYVNGPPGNLYPVYPYYSGQARSFSMGITPFLISGILWLLAF 138 >ref|XP_012857650.1| PREDICTED: extensin-like [Erythranthe guttatus] Length = 141 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 430 YIYINGPPGNLYPVDPYYSGASRRFSLGL-PFFICTVLGLIAF 305 YIYINGPPG++YPV PYYSG +RRFS+G+ PF I +L +AF Sbjct: 99 YIYINGPPGSVYPVYPYYSGGNRRFSVGIFPFLISFILWRLAF 141 >ref|XP_012833311.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Erythranthe guttatus] Length = 140 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 430 YIYINGPPGNLYPVDPYYSGASRRFSLGL-PFFICTVLGLIAF 305 YIYINGPPG++YPV PYYSG +RRFS+G+ PF I +L +AF Sbjct: 98 YIYINGPPGSVYPVYPYYSGGNRRFSVGIFPFLISFILWRLAF 140