BLASTX nr result
ID: Forsythia22_contig00003385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00003385 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532506.1| scythe/bat3, putative [Ricinus communis] gi|... 67 5e-16 ref|XP_011078367.1| PREDICTED: ubiquitin domain-containing prote... 60 2e-15 ref|XP_012081115.1| PREDICTED: large proline-rich protein bag6-l... 65 3e-15 ref|XP_012081116.1| PREDICTED: large proline-rich protein bag6-l... 65 3e-15 ref|XP_012081118.1| PREDICTED: large proline-rich protein bag6-l... 65 3e-15 ref|XP_007013657.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013659.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013661.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013658.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013655.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013656.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_007013662.1| Ubiquitin-like superfamily protein, putative... 64 4e-15 ref|XP_011081507.1| PREDICTED: uncharacterized protein LOC105164... 56 7e-15 ref|XP_011081509.1| PREDICTED: uncharacterized protein LOC105164... 56 8e-15 gb|KJB64610.1| hypothetical protein B456_010G057100 [Gossypium r... 63 2e-14 emb|CDP18808.1| unnamed protein product [Coffea canephora] 64 2e-14 gb|KJB64612.1| hypothetical protein B456_010G057100 [Gossypium r... 63 2e-14 gb|KJB64609.1| hypothetical protein B456_010G057100 [Gossypium r... 63 2e-14 gb|KJB64613.1| hypothetical protein B456_010G057100 [Gossypium r... 63 2e-14 ref|XP_012450051.1| PREDICTED: large proline-rich protein BAG6-l... 63 2e-14 >ref|XP_002532506.1| scythe/bat3, putative [Ricinus communis] gi|223527781|gb|EEF29882.1| scythe/bat3, putative [Ricinus communis] Length = 709 Score = 66.6 bits (161), Expect(2) = 5e-16 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGLSNHSA 108 Score = 43.9 bits (102), Expect(2) = 5e-16 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 KI D+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KIPGTDVAEGSETTIEIKLKTLDSQTYTLRVDKQMPVP 45 >ref|XP_011078367.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040153|ref|XP_011079060.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040155|ref|XP_011079791.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040157|ref|XP_011080560.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040159|ref|XP_011081295.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040161|ref|XP_011082001.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040163|ref|XP_011082758.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] gi|747040165|ref|XP_011083471.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Sesamum indicum] Length = 677 Score = 60.5 bits (145), Expect(2) = 2e-15 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLHLVVRQPV SS+ DHA Sbjct: 75 DDQLLSAYHVEDGHTLHLVVRQPVALSSELSDHA 108 Score = 48.5 bits (114), Expect(2) = 2e-15 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +2 Query: 11 GSEDVKISRNDMVEYSEATVEIKTKTLDSQTYTLR 115 G E +K+ ND E SE TVEIK KTLDSQT+TLR Sbjct: 5 GGERIKVPANDTAECSETTVEIKIKTLDSQTFTLR 39 >ref|XP_012081115.1| PREDICTED: large proline-rich protein bag6-like isoform X1 [Jatropha curcas] Length = 729 Score = 65.5 bits (158), Expect(2) = 3e-15 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV+PSSDG + A Sbjct: 84 DDQLLSAYHVEDGHTLHLVVRQPVLPSSDGLSNHPA 119 Score = 42.4 bits (98), Expect(2) = 3e-15 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 KI D E SE T+EIK KTLDSQTYTLR + +P Sbjct: 19 KIPMADEAEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 56 >ref|XP_012081116.1| PREDICTED: large proline-rich protein bag6-like isoform X2 [Jatropha curcas] gi|802665712|ref|XP_012081117.1| PREDICTED: large proline-rich protein bag6-like isoform X2 [Jatropha curcas] gi|643719318|gb|KDP30188.1| hypothetical protein JCGZ_16970 [Jatropha curcas] Length = 718 Score = 65.5 bits (158), Expect(2) = 3e-15 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV+PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVLPSSDGLSNHPA 108 Score = 42.4 bits (98), Expect(2) = 3e-15 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 KI D E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KIPMADEAEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_012081118.1| PREDICTED: large proline-rich protein bag6-like isoform X3 [Jatropha curcas] Length = 712 Score = 65.5 bits (158), Expect(2) = 3e-15 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV+PSSDG + A Sbjct: 84 DDQLLSAYHVEDGHTLHLVVRQPVLPSSDGLSNHPA 119 Score = 42.4 bits (98), Expect(2) = 3e-15 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 KI D E SE T+EIK KTLDSQTYTLR + +P Sbjct: 19 KIPMADEAEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 56 >ref|XP_007013657.1| Ubiquitin-like superfamily protein, putative isoform 3 [Theobroma cacao] gi|508784020|gb|EOY31276.1| Ubiquitin-like superfamily protein, putative isoform 3 [Theobroma cacao] Length = 730 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013659.1| Ubiquitin-like superfamily protein, putative isoform 5 [Theobroma cacao] gi|508784022|gb|EOY31278.1| Ubiquitin-like superfamily protein, putative isoform 5 [Theobroma cacao] Length = 729 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013661.1| Ubiquitin-like superfamily protein, putative isoform 7 [Theobroma cacao] gi|508784024|gb|EOY31280.1| Ubiquitin-like superfamily protein, putative isoform 7 [Theobroma cacao] Length = 725 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013658.1| Ubiquitin-like superfamily protein, putative isoform 4 [Theobroma cacao] gi|508784021|gb|EOY31277.1| Ubiquitin-like superfamily protein, putative isoform 4 [Theobroma cacao] Length = 724 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013655.1| Ubiquitin-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590578981|ref|XP_007013660.1| Ubiquitin-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508784018|gb|EOY31274.1| Ubiquitin-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508784023|gb|EOY31279.1| Ubiquitin-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 724 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013656.1| Ubiquitin-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|590578998|ref|XP_007013665.1| Ubiquitin-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508784019|gb|EOY31275.1| Ubiquitin-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508784028|gb|EOY31284.1| Ubiquitin-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 579 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_007013662.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] gi|590578991|ref|XP_007013663.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] gi|590578994|ref|XP_007013664.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] gi|508784025|gb|EOY31281.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] gi|508784026|gb|EOY31282.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] gi|508784027|gb|EOY31283.1| Ubiquitin-like superfamily protein, putative isoform 8 [Theobroma cacao] Length = 575 Score = 64.3 bits (155), Expect(2) = 4e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHA 215 DDQLLSAYHVEDGHTLH+VVRQPV PSSDG H+ Sbjct: 73 DDQLLSAYHVEDGHTLHMVVRQPVPPSSDGSPHS 106 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ R+ E SE T+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPRDSETEGSETTIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_011081507.1| PREDICTED: uncharacterized protein LOC105164545 isoform X1 [Sesamum indicum] gi|747069429|ref|XP_011081508.1| PREDICTED: uncharacterized protein LOC105164545 isoform X1 [Sesamum indicum] Length = 679 Score = 55.8 bits (133), Expect(2) = 7e-15 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSD 200 DDQLLSAYHVEDGHTLHLVVRQPV P+ + Sbjct: 75 DDQLLSAYHVEDGHTLHLVVRQPVPPTPE 103 Score = 50.8 bits (120), Expect(2) = 7e-15 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +2 Query: 11 GSEDVKISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 G E +K+S ND E SE TVEIK KTLDSQT+TLR + +P Sbjct: 5 GGEHIKVSGNDAAECSETTVEIKIKTLDSQTFTLRVDKRVPIP 47 >ref|XP_011081509.1| PREDICTED: uncharacterized protein LOC105164545 isoform X2 [Sesamum indicum] Length = 524 Score = 55.8 bits (133), Expect(2) = 8e-15 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSD 200 DDQLLSAYHVEDGHTLHLVVRQPV P+ + Sbjct: 75 DDQLLSAYHVEDGHTLHLVVRQPVPPTPE 103 Score = 50.8 bits (120), Expect(2) = 8e-15 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +2 Query: 11 GSEDVKISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 G E +K+S ND E SE TVEIK KTLDSQT+TLR + +P Sbjct: 5 GGEHIKVSGNDAAECSETTVEIKIKTLDSQTFTLRVDKRVPIP 47 >gb|KJB64610.1| hypothetical protein B456_010G057100 [Gossypium raimondii] Length = 720 Score = 63.2 bits (152), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVPPSSDGSPYHSA 108 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ + +E SEAT+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPSDTEMEGSEATIEIKIKTLDSQTYTLRVDKQMPVP 45 >emb|CDP18808.1| unnamed protein product [Coffea canephora] Length = 714 Score = 63.5 bits (153), Expect(2) = 2e-14 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDG 203 DDQLLSAYHVEDGHTLHLVVRQPV+PSS+G Sbjct: 75 DDQLLSAYHVEDGHTLHLVVRQPVVPSSEG 104 Score = 42.0 bits (97), Expect(2) = 2e-14 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +2 Query: 11 GSEDVKISRNDMVEYSEATVEIKTKTLDSQTYTLR 115 G ++ +S D SE TVEIK KTLDSQTYTLR Sbjct: 5 GDDNRVVSGKDEANCSETTVEIKIKTLDSQTYTLR 39 >gb|KJB64612.1| hypothetical protein B456_010G057100 [Gossypium raimondii] Length = 714 Score = 63.2 bits (152), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVPPSSDGSPYHSA 108 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ + +E SEAT+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPSDTEMEGSEATIEIKIKTLDSQTYTLRVDKQMPVP 45 >gb|KJB64609.1| hypothetical protein B456_010G057100 [Gossypium raimondii] Length = 713 Score = 63.2 bits (152), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVPPSSDGSPYHSA 108 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ + +E SEAT+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPSDTEMEGSEATIEIKIKTLDSQTYTLRVDKQMPVP 45 >gb|KJB64613.1| hypothetical protein B456_010G057100 [Gossypium raimondii] Length = 698 Score = 63.2 bits (152), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVPPSSDGSPYHSA 108 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ + +E SEAT+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPSDTEMEGSEATIEIKIKTLDSQTYTLRVDKQMPVP 45 >ref|XP_012450051.1| PREDICTED: large proline-rich protein BAG6-like isoform X1 [Gossypium raimondii] Length = 596 Score = 63.2 bits (152), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 114 DDQLLSAYHVEDGHTLHLVVRQPVIPSSDGFDHAEA 221 DDQLLSAYHVEDGHTLHLVVRQPV PSSDG + A Sbjct: 73 DDQLLSAYHVEDGHTLHLVVRQPVPPSSDGSPYHSA 108 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +2 Query: 26 KISRNDMVEYSEATVEIKTKTLDSQTYTLR*SAPLGLP 139 K+ + +E SEAT+EIK KTLDSQTYTLR + +P Sbjct: 8 KVPSDTEMEGSEATIEIKIKTLDSQTYTLRVDKQMPVP 45