BLASTX nr result
ID: Forsythia22_contig00002691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00002691 (517 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098100.1| PREDICTED: polyphenol oxidase I, chloroplast... 57 6e-06 >ref|XP_011098100.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum indicum] Length = 593 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -2 Query: 516 TFAQVPHRHKGPVKVKPSIRXXXXXXXXXXXXXXXDSILVTLVPRAGDVTIGGIKIIYA 340 TF+ VPH+H P+K+K R + IL+TLVP AGD+TIGGIKI YA Sbjct: 531 TFSHVPHKHDTPMKIKAQERLELQAPLEDLDVEGDEEILITLVPIAGDITIGGIKITYA 589