BLASTX nr result
ID: Forsythia22_contig00002230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00002230 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098919.1| PREDICTED: 60S ribosomal protein L7a [Sesamu... 110 4e-22 ref|XP_011097268.1| PREDICTED: 60S ribosomal protein L7a-like [S... 110 4e-22 gb|EYU34822.1| hypothetical protein MIMGU_mgv1a012259mg [Erythra... 110 4e-22 ref|XP_012840760.1| PREDICTED: 60S ribosomal protein L7a-like [E... 110 4e-22 ref|XP_012844020.1| PREDICTED: 60S ribosomal protein L7a [Erythr... 110 4e-22 gb|EPS63260.1| hypothetical protein M569_11521 [Genlisea aurea] 107 3e-21 ref|XP_012439025.1| PREDICTED: 60S ribosomal protein L7a [Gossyp... 100 5e-19 ref|XP_012489025.1| PREDICTED: 60S ribosomal protein L7a [Gossyp... 100 5e-19 gb|KJB38309.1| hypothetical protein B456_006G272400 [Gossypium r... 100 5e-19 gb|KJB38308.1| hypothetical protein B456_006G272400 [Gossypium r... 100 5e-19 ref|XP_012487641.1| PREDICTED: 60S ribosomal protein L7a-like [G... 100 5e-19 gb|KJB19784.1| hypothetical protein B456_003G118800 [Gossypium r... 100 5e-19 ref|XP_012471098.1| PREDICTED: 60S ribosomal protein L7a-like [G... 100 5e-19 ref|XP_012467620.1| PREDICTED: 60S ribosomal protein L7a-like [G... 100 5e-19 gb|KHG30185.1| 60S ribosomal L7a [Gossypium arboreum] 100 5e-19 gb|KHG25782.1| 60S ribosomal L7a [Gossypium arboreum] 100 5e-19 gb|KHG19415.1| 60S ribosomal L7a [Gossypium arboreum] 100 5e-19 gb|KHG09127.1| 60S ribosomal L7a [Gossypium arboreum] 100 5e-19 gb|KHF99595.1| 60S ribosomal L7a [Gossypium arboreum] 100 5e-19 ref|XP_007038052.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 fami... 100 5e-19 >ref|XP_011098919.1| PREDICTED: 60S ribosomal protein L7a [Sesamum indicum] Length = 258 Score = 110 bits (275), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 75 >ref|XP_011097268.1| PREDICTED: 60S ribosomal protein L7a-like [Sesamum indicum] Length = 256 Score = 110 bits (275), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ Sbjct: 23 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 73 >gb|EYU34822.1| hypothetical protein MIMGU_mgv1a012259mg [Erythranthe guttata] Length = 252 Score = 110 bits (275), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ Sbjct: 19 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 69 >ref|XP_012840760.1| PREDICTED: 60S ribosomal protein L7a-like [Erythranthe guttatus] gi|604329490|gb|EYU34821.1| hypothetical protein MIMGU_mgv1a012259mg [Erythranthe guttata] Length = 256 Score = 110 bits (275), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ Sbjct: 23 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 73 >ref|XP_012844020.1| PREDICTED: 60S ribosomal protein L7a [Erythranthe guttatus] gi|604321250|gb|EYU31838.1| hypothetical protein MIMGU_mgv1a012212mg [Erythranthe guttata] Length = 258 Score = 110 bits (275), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 75 >gb|EPS63260.1| hypothetical protein M569_11521 [Genlisea aurea] Length = 261 Score = 107 bits (267), Expect = 3e-21 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPP IHQ Sbjct: 28 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPAIHQ 78 >ref|XP_012439025.1| PREDICTED: 60S ribosomal protein L7a [Gossypium raimondii] gi|763784165|gb|KJB51236.1| hypothetical protein B456_008G208100 [Gossypium raimondii] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >ref|XP_012489025.1| PREDICTED: 60S ribosomal protein L7a [Gossypium raimondii] gi|763772916|gb|KJB40039.1| hypothetical protein B456_007G043600 [Gossypium raimondii] gi|763772917|gb|KJB40040.1| hypothetical protein B456_007G043600 [Gossypium raimondii] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >gb|KJB38309.1| hypothetical protein B456_006G272400 [Gossypium raimondii] Length = 250 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >gb|KJB38308.1| hypothetical protein B456_006G272400 [Gossypium raimondii] Length = 209 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >ref|XP_012487641.1| PREDICTED: 60S ribosomal protein L7a-like [Gossypium raimondii] gi|823179894|ref|XP_012487642.1| PREDICTED: 60S ribosomal protein L7a-like [Gossypium raimondii] gi|763771092|gb|KJB38307.1| hypothetical protein B456_006G272400 [Gossypium raimondii] Length = 259 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >gb|KJB19784.1| hypothetical protein B456_003G118800 [Gossypium raimondii] Length = 259 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >ref|XP_012471098.1| PREDICTED: 60S ribosomal protein L7a-like [Gossypium raimondii] gi|763752395|gb|KJB19783.1| hypothetical protein B456_003G118800 [Gossypium raimondii] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >ref|XP_012467620.1| PREDICTED: 60S ribosomal protein L7a-like [Gossypium raimondii] gi|763740476|gb|KJB07975.1| hypothetical protein B456_001G056300 [Gossypium raimondii] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >gb|KHG30185.1| 60S ribosomal L7a [Gossypium arboreum] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >gb|KHG25782.1| 60S ribosomal L7a [Gossypium arboreum] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >gb|KHG19415.1| 60S ribosomal L7a [Gossypium arboreum] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75 >gb|KHG09127.1| 60S ribosomal L7a [Gossypium arboreum] Length = 259 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >gb|KHF99595.1| 60S ribosomal L7a [Gossypium arboreum] Length = 259 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 26 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 76 >ref|XP_007038052.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] gi|508775297|gb|EOY22553.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] Length = 258 Score = 100 bits (248), Expect = 5e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 153 FEKRPKQFGIGGALPPKKDLHRFVKWPQVVRIQRKKMILKQRLKVPPPIHQ 1 FEKRPKQFGIGGALPPKKDLHRFVKWP+VVRIQRKK ILKQRLKVPP ++Q Sbjct: 25 FEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRKKRILKQRLKVPPALNQ 75