BLASTX nr result
ID: Forsythia22_contig00002052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00002052 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094688.1| PREDICTED: polyubiquitin-like [Sesamum indicum] 157 3e-36 ref|XP_012831912.1| PREDICTED: ubiquitin-40S ribosomal protein S... 153 5e-35 gb|EPS67722.1| hypothetical protein M569_07053 [Genlisea aurea] 137 4e-30 ref|WP_017321351.1| 30S ribosomal protein S19 [cyanobacterium PC... 114 3e-23 ref|WP_037217691.1| 30S ribosomal protein S19 [Richelia intracel... 113 4e-23 ref|WP_015955681.1| 30S ribosomal protein S19 [Cyanothece sp. PC... 113 6e-23 ref|WP_013324985.1| 30S ribosomal protein S19 [Cyanothece sp. PC... 112 7e-23 ref|WP_039458092.1| 30S ribosomal protein S19 [Thermus sp. 2.9] ... 112 1e-22 ref|YP_002601053.1| ribosomal protein S19 (chloroplast) [Monomas... 112 1e-22 ref|WP_003043865.1| 30S ribosomal protein S19 [Thermus aquaticus... 112 1e-22 ref|WP_023071160.1| 30S ribosomal protein S19 [Leptolyngbya sp. ... 112 1e-22 ref|WP_008231121.1| 30S ribosomal protein S19 [Richelia intracel... 112 1e-22 ref|WP_011173711.1| MULTISPECIES: 30S ribosomal protein S19 [The... 111 2e-22 pdb|1QKF|A Chain A, Solution Structure Of The Ribosomal Protein ... 111 2e-22 gb|AHK09983.1| ribosomal protein S19 [Prototheca wickerhamii] 111 2e-22 ref|YP_009019367.1| ribosomal protein S19 (chloroplast) [Auxenoc... 111 2e-22 ref|WP_006515911.1| 30S ribosomal protein S19 [Leptolyngbya sp. ... 111 2e-22 ref|WP_038061668.1| 30S ribosomal protein S19 [Thermus filiformi... 110 3e-22 ref|WP_028493563.1| 30S ribosomal protein S19 [Thermus antraniki... 110 3e-22 ref|WP_018111295.1| 30S ribosomal protein S19 [Thermus igniterrae] 110 4e-22 >ref|XP_011094688.1| PREDICTED: polyubiquitin-like [Sesamum indicum] Length = 627 Score = 157 bits (397), Expect = 3e-36 Identities = 78/98 (79%), Positives = 84/98 (85%), Gaps = 1/98 (1%) Frame = -3 Query: 292 LVLRLRGGGT-WRIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNG 116 LVLRLRGGGT WRIPFVANHLVKKI QLNQ + K+LIKTWSR STI+PEMVGHRIAVY+G Sbjct: 525 LVLRLRGGGTSWRIPFVANHLVKKIQQLNQNSRKELIKTWSRASTIVPEMVGHRIAVYDG 584 Query: 115 KKHVPFRISEQMVGHKLGELRPRRQARKEVQQKKATKK 2 KKHVPFRI E MVGHKLGELRPRR +KEV + T K Sbjct: 585 KKHVPFRILENMVGHKLGELRPRRLHKKEVHARGKTAK 622 >ref|XP_012831912.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Erythranthe guttatus] gi|604342592|gb|EYU41616.1| hypothetical protein MIMGU_mgv1a015017mg [Erythranthe guttata] Length = 170 Score = 153 bits (386), Expect = 5e-35 Identities = 75/97 (77%), Positives = 85/97 (87%), Gaps = 1/97 (1%) Frame = -3 Query: 292 LVLRLRGGGT-WRIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNG 116 LVLRLRGGGT WRIPFVANHLVKKI LN+ ++K+LIKTWSRGSTI+P+MVGHRIAV++G Sbjct: 69 LVLRLRGGGTSWRIPFVANHLVKKIKNLNEISKKELIKTWSRGSTIVPDMVGHRIAVHDG 128 Query: 115 KKHVPFRISEQMVGHKLGELRPRRQARKEVQQKKATK 5 KKHVPFRI E MVGHKLGEL+PRR +KEV K TK Sbjct: 129 KKHVPFRILETMVGHKLGELKPRRTHKKEVHAKGKTK 165 >gb|EPS67722.1| hypothetical protein M569_07053 [Genlisea aurea] Length = 172 Score = 137 bits (344), Expect = 4e-30 Identities = 62/93 (66%), Positives = 79/93 (84%), Gaps = 1/93 (1%) Frame = -3 Query: 292 LVLRLRGGGT-WRIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNG 116 LVLRLRGGGT WR+PFVANHL+KK+ Q+ + K+++KTW+RGSTIIP+MVGHR AV++G Sbjct: 69 LVLRLRGGGTSWRMPFVANHLMKKLKQMKESGRKEVVKTWARGSTIIPDMVGHRFAVHDG 128 Query: 115 KKHVPFRISEQMVGHKLGELRPRRQARKEVQQK 17 +KHV FRI E MVGHKLGEL+P+R RKE+ + Sbjct: 129 RKHVVFRIIEDMVGHKLGELKPKRLQRKEIHAR 161 >ref|WP_017321351.1| 30S ribosomal protein S19 [cyanobacterium PCC 7702] Length = 91 Score = 114 bits (284), Expect = 3e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+KKI +LNQ +K++IKTWSR STI+PEMVGH IAV+NG++HVP IS+QMVG Sbjct: 9 PFVADHLLKKIEKLNQSNKKEVIKTWSRASTILPEMVGHTIAVHNGRQHVPIYISDQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKA 11 HKLGE P R R + KKA Sbjct: 69 HKLGEFAPTRTFRGHAKDKKA 89 >ref|WP_037217691.1| 30S ribosomal protein S19 [Richelia intracellularis] gi|605045883|emb|CDN11390.1| SSU ribosomal protein S19p (S15e) [Richelia intracellularis] Length = 91 Score = 113 bits (283), Expect = 4e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+KKI +LN+K EK +IKTWSR STI+P+MVGH IAV+NG++HVP IS+QMVG Sbjct: 9 PFVADHLLKKIEKLNEKNEKQVIKTWSRASTILPDMVGHTIAVHNGRQHVPVFISDQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKA 11 HKLGE P R R + KKA Sbjct: 69 HKLGEFAPTRAYRGHARDKKA 89 >ref|WP_015955681.1| 30S ribosomal protein S19 [Cyanothece sp. PCC 7424] gi|226735172|sp|B7KHZ1.1|RS19_CYAP7 RecName: Full=30S ribosomal protein S19 [Cyanothece sp. PCC 7424] gi|218173355|gb|ACK72088.1| ribosomal protein S19 [Cyanothece sp. PCC 7424] Length = 92 Score = 113 bits (282), Expect = 6e-23 Identities = 53/84 (63%), Positives = 64/84 (76%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+ KI +LN+K EK +IKTWSR STIIP+MVGH IAV+NGK+HVP ISEQMVG Sbjct: 9 PFVADHLLSKIEKLNEKGEKQVIKTWSRASTIIPDMVGHTIAVHNGKQHVPIFISEQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKATKK 2 HKLGE P R R + K ++ Sbjct: 69 HKLGEFAPTRTFRGHAKSDKKARR 92 >ref|WP_013324985.1| 30S ribosomal protein S19 [Cyanothece sp. PCC 7822] gi|306985066|gb|ADN16947.1| ribosomal protein S19 [Cyanothece sp. PCC 7822] Length = 92 Score = 112 bits (281), Expect = 7e-23 Identities = 53/84 (63%), Positives = 63/84 (75%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+ KI +LN K EK +IKTWSR STIIP+MVGH IAV+NGK+HVP ISEQMVG Sbjct: 9 PFVADHLLSKIEKLNDKGEKQVIKTWSRASTIIPDMVGHTIAVHNGKQHVPIYISEQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKATKK 2 HKLGE P R R + K ++ Sbjct: 69 HKLGEFAPTRTFRGHAKSDKKARR 92 >ref|WP_039458092.1| 30S ribosomal protein S19 [Thermus sp. 2.9] gi|729023611|gb|KHG65348.1| 30S ribosomal protein S19 [Thermus sp. 2.9] Length = 93 Score = 112 bits (279), Expect = 1e-22 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++KI +LN K EK LIKTWSR STI+PEMVGH IAVYNGK+HVP I+E MVGH Sbjct: 10 FVDDHLLEKILELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92 >ref|YP_002601053.1| ribosomal protein S19 (chloroplast) [Monomastix sp. OKE-1] gi|217314563|gb|ACK36906.1| ribosomal protein S19 (chloroplast) [Monomastix sp. OKE-1] Length = 110 Score = 112 bits (279), Expect = 1e-22 Identities = 51/86 (59%), Positives = 66/86 (76%) Frame = -3 Query: 259 RIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQM 80 R PF+ANHL KKI +LN K+EK +I+TWSRGSTI+P M+GH IAV+NGK+H+P I++QM Sbjct: 25 RPPFIANHLFKKIVELNNKSEKKVIQTWSRGSTIVPMMIGHTIAVHNGKEHIPVFITDQM 84 Query: 79 VGHKLGELRPRRQARKEVQQKKATKK 2 VGHKLGE P R R ++ K K+ Sbjct: 85 VGHKLGEFSPTRTFRGHIKTDKKGKR 110 >ref|WP_003043865.1| 30S ribosomal protein S19 [Thermus aquaticus] gi|218244666|gb|EED11190.1| ribosomal protein S19 [Thermus aquaticus Y51MC23] Length = 93 Score = 112 bits (279), Expect = 1e-22 Identities = 54/83 (65%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ +LN K EK LIKTWSR STI+PEMVGH IAVYNGK+HVP I+E MVGH Sbjct: 10 FVDDHLLEKVRELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92 >ref|WP_023071160.1| 30S ribosomal protein S19 [Leptolyngbya sp. Heron Island J] gi|553086474|gb|ESA38038.1| 30s ribosomal protein s19 [Leptolyngbya sp. Heron Island J] Length = 92 Score = 112 bits (279), Expect = 1e-22 Identities = 51/84 (60%), Positives = 65/84 (77%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+KKI +LN K +K +IKTWSR STIIP+M+GH IAV+NG++HVP +SEQMVG Sbjct: 9 PFVADHLLKKIEKLNVKGDKQVIKTWSRASTIIPQMIGHTIAVHNGRQHVPVYVSEQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKATKK 2 HKLGE P R R V+ K ++ Sbjct: 69 HKLGEFAPTRTFRGHVKSDKKARR 92 >ref|WP_008231121.1| 30S ribosomal protein S19 [Richelia intracellularis] gi|471316924|emb|CCH66116.1| SSU ribosomal protein S19p (S15e) [Richelia intracellularis HM01] Length = 91 Score = 112 bits (279), Expect = 1e-22 Identities = 51/83 (61%), Positives = 66/83 (79%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL+KKI +LN+K EK +IKTWSR STI+P+MVGH IAV+NG++H+P IS+QMVG Sbjct: 9 PFVADHLLKKIERLNEKNEKQVIKTWSRASTILPDMVGHTIAVHNGRQHIPVFISDQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKATK 5 HKLGE P R R + KK ++ Sbjct: 69 HKLGEFAPTRTYRGHSKDKKVSR 91 >ref|WP_011173711.1| MULTISPECIES: 30S ribosomal protein S19 [Thermus] gi|55981657|ref|YP_144954.1| 30S ribosomal protein S19 [Thermus thermophilus HB8] gi|6094166|sp|P80381.3|RS19_THETH RecName: Full=30S ribosomal protein S19 gi|50401373|sp|P62660.2|RS19_THET2 RecName: Full=30S ribosomal protein S19 [Thermus thermophilus HB27] gi|62900933|sp|Q5SHP2.3|RS19_THET8 RecName: Full=30S ribosomal protein S19 gi|10120582|pdb|1FKA|S Chain S, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution gi|10835603|pdb|1FJG|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin gi|13096412|pdb|1HR0|S Chain S, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit gi|13399810|pdb|1HNW|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline gi|13399832|pdb|1HNX|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin gi|13399854|pdb|1HNZ|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B gi|14278028|pdb|1GIX|V Chain V, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy gi|14278074|pdb|1IBK|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin gi|14278095|pdb|1IBL|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin gi|14278119|pdb|1IBM|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site gi|15826138|pdb|1JGO|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy gi|15826163|pdb|1JGP|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy gi|15826188|pdb|1JGQ|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy gi|28373717|pdb|1ML5|V Chain V, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 gi|58177418|pdb|1XMO|S Chain S, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center gi|58177441|pdb|1XMQ|S Chain S, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center gi|58177482|pdb|1XNQ|S Chain S, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center gi|58177505|pdb|1XNR|S Chain S, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center gi|66361072|pdb|1YL4|V Chain V, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. 30s Subunit. The Coordinates For The 50s Subunit Are In The Pdb Entry 1yl3 gi|88192254|pdb|2B64|S Chain S, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf1 And Is Described In Remark 400. gi|88192317|pdb|2B9M|S Chain S, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf2 And Is Described In Remark 400. gi|88192373|pdb|2B9O|S Chain S, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site. This File Contains The 30s Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site And Is Described In Remark 400. gi|110591341|pdb|2F4V|S Chain S, 30s Ribosome + Designer Antibiotic gi|116667672|pdb|2HHH|S Chain S, Crystal Structure Of Kasugamycin Bound To The 30s Ribosomal Subunit gi|116668215|pdb|2J00|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E-Site Trnas And Paromomycin For Molecule I. gi|116668276|pdb|2J02|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4) This File Contains The 30s Subunit, Mrna, A-, P- And E-Site Trnas And Paromomycin For Molecule Ii. gi|119389730|pdb|2HGI|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. gi|119389787|pdb|2HGP|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgq. gi|119389843|pdb|2HGR|V Chain V, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgu. gi|149242726|pdb|2OW8|TT Chain t, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 2ow8, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsa. gi|149243636|pdb|2UU9|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-asl With Cmo5u In Position 34 Bound To An Mrna With A Gug-codon In The A-site And Paromomycin. gi|149243663|pdb|2UUA|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guc-Codon In The A-Site And Paromomycin. gi|149243690|pdb|2UUB|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guu-Codon In The A-Site And Paromomycin. gi|149243717|pdb|2UUC|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-asl With Cmo5u In Position 34 Bound To An Mrna With A Gua-codon In The A-site And Paromomycin. gi|149243856|pdb|2UXC|S Chain S, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Ucgu In The Context Of The Thermus Thermophilus 30s Subunit. gi|157836426|pdb|2UXB|S Chain S, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Gggu In The Context Of The Thermus Thermophilus 30s Subunit. gi|157836503|pdb|2V46|S Chain S, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 1. gi|157836559|pdb|2V48|S Chain S, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 3 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 2. gi|158430918|pdb|2UXD|S Chain S, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Cggg In The Context Of The Thermus Thermophilus 30s Subunit. gi|160285957|pdb|2QNH|TT Chain t, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 2qnh, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsp. gi|186972867|pdb|2VQE|S Chain S, Modified Uridines With C5-methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-g Wobble Pairing During Decoding gi|186972890|pdb|2VQF|S Chain S, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding gi|209156514|pdb|3D5A|S Chain S, Structural Basis For Translation Termination On The 70s Ribosome. This File Contains The 30s Subunit, Release Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. gi|209156570|pdb|3D5C|S Chain S, Structural Basis For Translation Termination On The 70s Ribosome. This File Contains The 30s Subunit, Release Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. gi|218766791|pdb|3F1E|S Chain S, Crystal Structure Of A Translation Termination Complex Formed With Release Factor Rf2. This File Contains The 30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. gi|218766847|pdb|3F1G|S Chain S, Crystal Structure Of A Translation Termination Complex Formed With Release Factor Rf2. This File Contains The 30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. gi|226887392|pdb|2WDG|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Mrna, Paromomycin, Acylated A-Site Trna, Deacylated P-Site Trna, And E-Site Trna. This File Contains The 30s Subunit A-,P-, And E-Site Trnas And Paromomycin For Molecule I. gi|226887417|pdb|2WDH|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Mrna, Paromomycin, Acylated A-Site Trna, Deacylated P-Site Trna, And E-Site Trna. This File Contains The 30s Subunit A-,P-, And E-Site Trnas And Paromomycin For Molecule Ii. gi|226887506|pdb|2WDK|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Mrna, Paromomycin, Acylated A- And P-Site Trnas, And E-Site Trna. This File Contains The 30s Subunit A-,P-, And E-Site Trnas And Paromomycin For Molecule I. gi|226887563|pdb|2WDM|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Mrna, Paromomycin, Acylated A- And P-Site Trnas, And E-Site Trna. This File Contains The 30s Subunit A-,P-, And E-Site Trnas And Paromomycin For Molecule Ii. gi|237823547|pdb|2WH1|S Chain S, Insights Into Translational Termination From The Structure Of Rf2 Bound To The Ribosome gi|237823606|pdb|2WH3|S Chain S, Insights Into Translational Termination From The Structure Of Rf2 Bound To The Ribosome). This File Contains The 30s Subunit. gi|260100004|pdb|3HUW|S Chain S, Structure Of Ef-p Bound To The 70s Ribosome; This File Contains The 30s Subunit, Mrna, P-site Trna And Ef-p For Molecule I. gi|260100060|pdb|3HUY|S Chain S, Structure Of Ef-p Bound To The 70s Ribosome; This File Contains The 30s Subunit, Mrna, P-site Trna And Ef-p For Molecule Ii. gi|261824502|pdb|2WRI|S Chain S, The Structure Of The Ribosome With Elongation Factor G Trapped In The Post-Translocational State (Part 1 Of 4). gi|261824564|pdb|2WRK|S Chain S, The Structure Of The Ribosome With Elongation Factor G Trapped In The Post-Translocational State (Part 3 Of 4). gi|261824626|pdb|2WRN|S Chain S, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). gi|261824685|pdb|2WRQ|S Chain S, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 3 Of 4). gi|281307185|pdb|3KIQ|SS Chain s, Structure Of Rele Nuclease Bound To The 70s Ribosome (Precleavage State; Part 1 Of 4) gi|281307243|pdb|3KIS|SS Chain s, Structure Of Rele Nuclease Bound To The 70s Ribosome (Precleavage State; Part 3 Of 4) gi|281307301|pdb|3KIU|SS Chain s, Structure Of Rele Nuclease Bound To The 70s Ribosome (Postcleavage State; Part 1 Of 4) gi|281307359|pdb|3KIX|SS Chain s, Structure Of Rele Nuclease Bound To The 70s Ribosome (Postcleavage State; Part 3 Of 4) gi|288965622|pdb|3KNH|S Chain S, The Structures Of Viomycin Bound To The 70s Ribosome. This File Contains The 30s Subunit For Molecule I gi|289526700|pdb|3KNJ|S Chain S, The Structures Of Viomycin Bound To The 70s Ribosome. This File Contains The 30s Subunit For Molecule Ii' gi|289526725|pdb|3KNL|S Chain S, The Structures Of Capreomycin Bound To The 70s Ribosome. This File Contains The 30s Subunit For Molecule I gi|289526750|pdb|3KNN|S Chain S, The Structures Of Capreomycin Bound To The 70s Ribosome. This File Contains The 30s Subunit For Molecule Ii gi|294979413|pdb|3A1P|B Chain B, Structure Of Ribosome Maturation Protein Rimm And Ribosomal Protein S19 gi|294979415|pdb|3A1P|D Chain D, Structure Of Ribosome Maturation Protein Rimm And Ribosomal Protein S19 gi|294979522|pdb|3I8G|V Chain V, Elongation Complex Of The 70s Ribosome With Three Trnas And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f (50s). gi|294979547|pdb|3I8H|V Chain V, Elongation Complex Of The 70s Ribosome With Three Trnas And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g (30s). gi|294979606|pdb|3I9B|V Chain V, Initiation Complex Of 70s Ribosome With Two Trnas And Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule B. The 50s Subunit Can Be Found In Pdb Entry 3i9c. Molecule A In The S Asymmetric Unit Is Deposited As 3i9d (30s) And 3i9e (50s) gi|294979660|pdb|3I9D|V Chain V, Initiation Complex Of 70s Ribosome With Two Trnas And Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule A. The 50s Subunit Can Be Found In Pdb Entry 3i9e. Molecule B In The S Asymmetric Unit Is Deposited As 3i9b (30s) And 3i9c (50s) gi|295982093|pdb|2X9R|S Chain S, Structure Of The 70s Ribosome Bound To Release Factor 2 And A Substrate Analog Provides Insights Into Catalysis Of Peptide Release gi|295982152|pdb|2X9T|S Chain S, Structure Of The 70s Ribosome Bound To Release Factor 2 And A Substrate Analog Provides Insights Into Catalysis Of Peptide Release gi|307567980|pdb|2XFZ|S Chain S, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 1 Of 4) gi|307568038|pdb|2XG1|S Chain S, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 3 Of 4) gi|307776630|pdb|3OTO|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From A Ksga Mutant Of Thermus Thermophilus (Hb8) gi|309320253|pdb|3OGE|S Chain S, Structure Of The Thermus Thermophilus Ribosome Complexed With Chloramphenicol. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320274|pdb|3OGY|S Chain S, Structure Of The Thermus Thermophilus Ribosome Complexed With Chloramphenicol. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320355|pdb|3OHC|S Chain S, Structure Of The Thermus Thermophilus Ribosome Complexed With Erythromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320376|pdb|3OHD|S Chain S, Structure Of The Thermus Thermophilus Ribosome Complexed With Erythromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320457|pdb|3OHY|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Azithromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320508|pdb|3OI0|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Azithromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320559|pdb|3OI2|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Telithromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|309320610|pdb|3OI4|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Telithromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|312207691|pdb|2XQD|S Chain S, The Structure Of Ef-tu And Aminoacyl-trna Bound To The 70s Ribosome With A Gtp Analog gi|313754017|pdb|2XSY|S Chain S, Trna Tranlocation On The 70s Ribosome: The Pre- Translocational Translocation Intermediate Ti(Pre) gi|313754132|pdb|2XUY|S Chain S, Trna Translocation On The 70s Ribosome: The Post- Translocational Translocation Intermediate Ti(Post) gi|325533420|pdb|2Y0U|S Chain S, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome gi|325533479|pdb|2Y0W|S Chain S, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome gi|325533538|pdb|2Y0Y|S Chain S, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome gi|325533597|pdb|2Y10|S Chain S, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A Cognate Codon On The 70s Ribosome. gi|325533656|pdb|2Y12|S Chain S, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome gi|325533715|pdb|2Y14|S Chain S, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Cognate Codon On The 70s Ribosome. gi|325533774|pdb|2Y16|S Chain S, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Cognate Codon On The 70s Ribosome. gi|325533833|pdb|2Y18|S Chain S, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A Cognate Codon On The 70s Ribosome. gi|347948813|pdb|3ZVO|S Chain S, Crystal Structure Of The Hybrid State Of Ribosome In Complex With The Guanosine Triphosphatase Release Factor 3 gi|374074281|pdb|3T1H|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Human Anti-Codon Stem Loop (Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An Mrna With An Aaa-Codon In The A-Site And Paromomycin gi|374074306|pdb|3T1Y|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Human Anti-Codon Stem Loop (Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An Mrna With An Aag-Codon In The A-Site And Paromomycin gi|374074523|pdb|3UXS|S Chain S, The Structure Of Thermorubin In Complex With The 70s Ribosome From Thermus Thermophilus. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. gi|374074544|pdb|3UXT|S Chain S, The Structure Of Thermorubin In Complex With The 70s Ribosome From Thermus Thermophilus. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes.' gi|380764260|pdb|3TVF|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex gi|380764285|pdb|3TVG|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex gi|380764362|pdb|3UYD|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Leu Complex gi|380764418|pdb|3UYF|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Leu Complex gi|380764538|pdb|3UZ3|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Leu Complex With Paromomycin. gi|380764563|pdb|3UZ4|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Leu Complex With Paromomycin. gi|380764589|pdb|3UZ6|V Chain V, Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Tyr Complex gi|380764615|pdb|3UZ7|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit For The Cognate Trna-Tyr Complex. gi|380764735|pdb|3UZG|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Tyr Complex gi|380764791|pdb|3UZI|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Tyr Complex gi|380764846|pdb|3UZL|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Near-Cognate Trna-Tyr Complex With Paromomycin gi|380764872|pdb|3UZM|V Chain V, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit For The Near-cognate Trna-tyr Complex With Paromomycin gi|381353106|pdb|4ABR|S Chain S, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome gi|381353210|pdb|4DH9|S Chain S, Crystal Structure Of Yaej Bound To The 70s Ribosome gi|381353265|pdb|4DHB|S Chain S, Crystal Structure Of Yaej Bound To The 70s Ribosome gi|388325961|pdb|3V22|S Chain S, Crystal Structure Of Rmf Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Rmf Of The 1st Ribosome In The Asu gi|388326014|pdb|3V24|S Chain S, Crystal Structure Of Rmf Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Rmf Of The 2nd Ribosome In The Asu gi|388326067|pdb|3V26|S Chain S, Crystal Structure Of Hpf Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Hpf Of The 1st Ribosome In The Asu gi|388326120|pdb|3V28|S Chain S, Crystal Structure Of Hpf Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Hpf Of The 2nd Ribosome In The Asu gi|388326243|pdb|3V2C|S Chain S, Crystal Structure Of Yfia Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Yfia Of The 1st Ribosome In The Asu gi|388326296|pdb|3V2E|S Chain S, Crystal Structure Of Yfia Bound To The 70s Ribosome. This Pdb Entry Contains Coordinates For The 30s Subunit With Bound Yfia Of The 2nd Ribosome In The Asu gi|414145525|pdb|4DR1|S Chain S, Crystal Structure Of The Apo 30s Ribosomal Subunit From Thermus Thermophilus (hb8) gi|414145546|pdb|4DR2|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Multiple Copies Of Paromomycin Molecules Bound gi|414145567|pdb|4DR3|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Streptomycin Bound gi|414145588|pdb|4DR4|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Codon, Cognate Transfer Rna Anticodon Stem-loop And Multiple Copies Of Paromomycin Molecules Bound gi|414145611|pdb|4DR5|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Codon, Crystallographically Disordered Cognate Transfer Rna Anticodon Stem-loop And Streptomycin Bound gi|414145634|pdb|4DR6|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Codon, Near-cognate Transfer Rna Anticodon Stem-loop Mismatched At The First Codon Position And Streptomycin Bound gi|414145659|pdb|4DR7|S Chain S, Crystal Structure Of The Thermus Thermophilus (hb8) 30s Ribosomal Subunit With Codon, Crystallographically Disordered Near-cognate Transfer Rna Anticodon Stem-loop Mismatched At The Second Codon Position, And Streptomycin Bound gi|451928707|pdb|4G5K|V Chain V, Crystal Structure Of The 70s Ribosome With Tetracycline. This Entry Contains The 30s Subunit Of Molecule A. gi|451928760|pdb|4G5M|V Chain V, Crystal Structure Of The 70s Ribosome With Tetracycline. This Entry Contains The 30s Subunit Of Molecule B. gi|451928813|pdb|4G5T|V Chain V, Crystal Structure Of The 70s Ribosome With Tigecycline. This Entry Contains The 30s Subunit Of Molecule A. gi|451928867|pdb|4G5V|V Chain V, Crystal Structure Of The 70s Ribosome With Tigecycline. This Entry Contains The 30s Subunit Of Molecule B. gi|453055767|pdb|4DUY|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, U13c gi|453055788|pdb|4DUZ|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, U13c, Bound With Streptomycin gi|453055809|pdb|4DV0|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, U20g gi|453055830|pdb|4DV1|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, U20g, Bound With Streptomycin gi|453055851|pdb|4DV2|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, C912a gi|453055872|pdb|4DV3|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, C912a, Bound With Streptomycin gi|453055893|pdb|4DV4|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, A914g gi|453055914|pdb|4DV5|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, A914g, Bound With Streptomycin gi|453055935|pdb|4DV6|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, A915g gi|453055956|pdb|4DV7|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit With A 16s Rrna Mutation, A915g, Bound With Streptomycin gi|474452962|pdb|3ZN7|S Chain S, The Crystal Structure Of Agmatidine Trna-ile2 Bound To The 70s Ribosome In The A And P Site. gi|474453020|pdb|3ZND|S Chain S, The Crystal Structure Of Agmatidine Trna-ile2 Bound To The 70s Ribosome In The A And P Site. gi|474453099|pdb|4B8F|S Chain S, Crystal Structure Of 70s Ribosome With Both Cognate Trnas In The E And P Sites Representing An Authentic Elongation Complex gi|474453156|pdb|4B8H|S Chain S, Crystal Structure Of 70s Ribosome With Both Cognate Trnas In The E And P Sites Representing An Authentic Elongation Complex gi|482676680|pdb|3V6U|S Chain S, Crystal Structure Of The Bacterial Ribosome Ram Mutation G347u. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit gi|482676705|pdb|3V6V|S Chain S, Crystal Structure Of The Bacterial Ribosome Ram Mutation G347u. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit gi|482677008|pdb|4EJ9|S Chain S, Crystal Structure Of The Bacterial Ribosome Ram Mutation G299a. This Entry Contains The 30s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit gi|482677033|pdb|4EJA|S Chain S, Crystal Structure Of The Bacterial Ribosome Ram Mutation G299a. This Entry Contains The 30s Ribosomal Subunit Of The Second 70s Molecule In The Asymmetric Unit gi|534286172|pdb|4BYB|S Chain S, Structure Of Thermus Thermophilus 30s Ribosome gi|534286236|pdb|4BYD|S Chain S, Structure Of Thermus Thermophilus 30s Ribosome gi|557129284|pdb|4JI0|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129305|pdb|4JI1|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129326|pdb|4JI2|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129347|pdb|4JI3|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129368|pdb|4JI4|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129389|pdb|4JI5|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129410|pdb|4JI6|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129431|pdb|4JI7|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|557129452|pdb|4JI8|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|594146154|pdb|4CR1|S Chain S, Thermus Thermophilus Ribosome gi|605604030|pdb|4NVU|S Chain S, Crystal Structure Of Antibiotic Dityromycin Bound To 70s Ribosome gi|605604093|pdb|4NVW|S Chain S, Crystal Structure Of Antibiotic Dityromycin Bound To 70s Ribosome gi|605604165|pdb|4NVY|S Chain S, Crystal Structure Of Antibiotic Ge82832 Bound To 70s Ribosome gi|605604225|pdb|4NW0|S Chain S, Crystal Structure Of Antibiotic Ge82832 Bound To 70s Ribosome gi|636666454|pdb|4NXM|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From A Gidb (rsmg) Mutant Of Thermus Thermophilus (hb8) gi|636666475|pdb|4NXN|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From A Gidb (rsmg) Mutant Of Thermus Thermophilus (hb8), Bound With Streptomycin gi|645985682|pdb|4KVB|S Chain S, Thermus Thermophilus Hb27 30s Ribosomal Subunit Lacking Ribosomal Protein S17 gi|661918136|pdb|4LF4|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918157|pdb|4LF5|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918178|pdb|4LF6|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918199|pdb|4LF7|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918220|pdb|4LF8|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918241|pdb|4LF9|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918262|pdb|4LFA|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918283|pdb|4LFB|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|661918304|pdb|4LFC|S Chain S, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus gi|672884591|pdb|1VVL|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-u On The Ribosome gi|672884647|pdb|1VVN|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-u On The Ribosome gi|672884703|pdb|1VVP|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-a On The Ribosome gi|672884759|pdb|1VVR|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-a On The Ribosome gi|672884815|pdb|1VVT|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccg-g On The Ribosome gi|672884871|pdb|1VVV|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccg-g On The Ribosome gi|672884927|pdb|1VVX|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-u In The Absence Of Paromomycin gi|672884983|pdb|1VVZ|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-u In The Absence Of Paromomycin gi|672885039|pdb|1VX8|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccc-u On The Ribosome gi|672885095|pdb|1VXI|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccc-u On The Ribosome gi|672885151|pdb|1VXK|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccg-g On The Ribosome gi|672885207|pdb|1VXM|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccg-g On The Ribosome gi|672885263|pdb|1VXP|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccc-g On The Ribosome gi|672885319|pdb|1VXS|S Chain S, Crystal Structure Of Trna Proline (cgg) Bound To Codon Ccc-g On The Ribosome gi|672885667|pdb|4KWZ|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-g On The Ribosome gi|672885722|pdb|4KX1|S Chain S, Crystal Structure Of Frameshift Suppressor Trna Sufa6 Bound To Codon Ccc-g On The Ribosome gi|672886130|pdb|1VY0|S Chain S, Crystal Structure Of Unmodified Trna Proline (cgg) Bound To Codon Ccg On The Ribosome gi|672886186|pdb|1VY2|S Chain S, Crystal Structure Of Unmodified Trna Proline (cgg) Bound To Codon Ccg On The Ribosome gi|673541440|pdb|4QCM|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Acylated Trna- Substrates In The A And P Sites. This Entry Contains The 30s Subunit Of The First 70s Ribosome In The Asu. gi|673541496|pdb|4QCO|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Acylated Trna- Substrates In The A And P Sites. This Entry Contains The 30s Subunit Of The Second 70s Ribosome In The Asu. gi|673541552|pdb|4QCQ|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Post-catalysis State Of Peptide Bond Formation Containing Dipeptydil- Trna In The A Site And Deacylated Trna In The P Site. This Entry Contains The 50s Subunit Of The First 70s Ribosome In The Asu. gi|673541608|pdb|4QCS|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Post-catalysis State Of Peptide Bond Formation Containing Dipeptydil- Trna In The A Site And Deacylated Trna In The P Site. This Entry Contains The 30s Subunit Of The Second 70s Ribosome In The Asu. gi|673541664|pdb|4QCU|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Short Substrate- Mimic Cytidine-puromycin In The A Site And Acylated Trna In The P Site. This Entry Contains The 30s Subunit Of The First 70s Ribosome In The Asu. gi|673541719|pdb|4QCW|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Short Substrate- Mimic Cytidine-puromycin In The A Site And Acylated Trna In The P Site. This Entry Contains The 30s Subunit Of The Second 70s Ribosome In The Asu. gi|673541774|pdb|4QCY|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Short Substrate- Mimic Cytidine-cytidine-puromycin In The A Site And Acylated Trna In The P Site. This Entry Contains The 30s Subunit Of The First 70s Ribosome In The Asu. gi|673541830|pdb|4QD0|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In The Pre- Attack State Of Peptide Bond Formation Containing Short Substrate- Mimic Cytidine-cytidine-puromycin In The A Site And Acylated Trna In The P Site. This Entry Contains The 30s Subunit Of The Second 70s Ribosome In The Asu. gi|695721365|pdb|4W2A|T Chain T, Crystal Structure Of The Peptolide 12c Bound To Bacterial Ribosome gi|695721432|pdb|4W2C|T Chain T, Crystal Structure Of The Peptolide 12c Bound To Bacterial Ribosome gi|697351055|pdb|4RB5|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Amicoumacin, Mrna And Three Deacylated Trnas In The A, P And E Sites gi|697351111|pdb|4RB7|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Amicoumacin, Mrna And Three Deacylated Trnas In The A, P And E Sites gi|697351167|pdb|4RB9|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Pactamycin (soaked), Mrna And Three Deacylated Trnas In The A, P And E Sites gi|697351223|pdb|4RBB|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Pactamycin (soaked), Mrna And Three Deacylated Trnas In The A, P And E Sites gi|697351279|pdb|4RBD|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Pactamycin (co-crystallized), Mrna And Deacylated Trna In The P Site gi|697351334|pdb|4RBF|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Pactamycin (co-crystallized), Mrna And Deacylated Trna In The P Site gi|697351389|pdb|4RBH|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Negamycin, Mrna And Three Deacylated Trnas In The A, P And E Sites gi|697351445|pdb|4RBJ|S Chain S, Crystal Structure Of The Thermus Thermophilus 70s Ribosome In Complex With Negamycin, Mrna And Three Deacylated Trnas In The A, P And E Sites gi|720065907|pdb|4QJT|SS Chain s, Crystal Structure Of Elongation Factor 4 (ef4/lepa) Bound To The Thermus Thermophilus 70s Ribosome, 30s Subunit Of The 70s Ribosome gi|2578816|emb|CAA58878.1| ribosomal protein S19 [Thermus thermophilus] gi|46197252|gb|AAS81666.1| SSU ribosomal protein S19P [Thermus thermophilus HB27] gi|55773070|dbj|BAD71511.1| 30S ribosomal protein S19 [Thermus thermophilus HB8] gi|320151465|gb|ADW22843.1| 30S ribosomal protein S19 [Thermus scotoductus SA-01] gi|333967336|gb|AEG34101.1| ribosomal protein S19 [Thermus thermophilus SG0.5JP17-16] gi|359289998|gb|AEV15515.1| 30S ribosomal protein S19 [Thermus sp. CCB_US3_UF1] gi|383508834|gb|AFH38266.1| ribosomal protein S19, bacterial/organelle [Thermus thermophilus JL-18] gi|410696289|gb|AFV75357.1| ribosomal protein S19, bacterial/organelle [Thermus oshimai JL-2] gi|568399282|gb|ETN88821.1| 30S ribosomal protein S19 [Thermus sp. NMX2.A1] Length = 93 Score = 111 bits (278), Expect = 2e-22 Identities = 54/83 (65%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ +LN K EK LIKTWSR STI+PEMVGH IAVYNGK+HVP I+E MVGH Sbjct: 10 FVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92 >pdb|1QKF|A Chain A, Solution Structure Of The Ribosomal Protein S19 From Thermus Thermophilus gi|5822310|pdb|1QKH|A Chain A, Solution Structure Of The Ribosomal Protein S19 From Thermus Thermophilus gi|14278548|pdb|1I94|S Chain S, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 gi|14278569|pdb|1I95|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine gi|14278590|pdb|1I96|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) gi|14278612|pdb|1I97|S Chain S, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline gi|20663904|pdb|1J5E|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit gi|27065894|pdb|1N32|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin gi|27065921|pdb|1N33|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin gi|27065948|pdb|1N34|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position gi|27065974|pdb|1N36|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-cognate Transfer Rna Anticodon Stem-loop Mismatched At The Second Codon Position gi|149241293|pdb|2E5L|S Chain S, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction gi|226887647|pdb|2ZM6|S Chain S, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit gi|395759352|pdb|4AQY|S Chain S, Structure Of Ribosome-apramycin Complexes gi|529280812|pdb|4B3M|S Chain S, Crystal Structure Of The 30s Ribosome In Complex With Compound 1 gi|529280835|pdb|4B3R|S Chain S, Crystal Structure Of The 30s Ribosome In Complex With Compound 30 gi|529280858|pdb|4B3S|S Chain S, Crystal Structure Of The 30s Ribosome In Complex With Compound 37 gi|529280881|pdb|4B3T|S Chain S, Crystal Structure Of The 30s Ribosome In Complex With Compound 39 gi|609412581|pdb|4OX9|S Chain S, Crystal Structure Of The Aminoglycoside Resistance Methyltransferase Npma Bound To The 30s Ribosomal Subunit Length = 92 Score = 111 bits (278), Expect = 2e-22 Identities = 54/83 (65%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ +LN K EK LIKTWSR STI+PEMVGH IAVYNGK+HVP I+E MVGH Sbjct: 9 FVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGH 68 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 69 KLGEFAPTRTYRGHGKEAKATKK 91 >gb|AHK09983.1| ribosomal protein S19 [Prototheca wickerhamii] Length = 92 Score = 111 bits (277), Expect = 2e-22 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = -3 Query: 259 RIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQM 80 +IPFVANHL+KKI +LN + +K +IKTWSR STI+P M+GH IAV+NG++H+P I++QM Sbjct: 7 KIPFVANHLLKKIERLNIQDKKKVIKTWSRASTIVPLMIGHTIAVHNGRQHIPLFITDQM 66 Query: 79 VGHKLGELRPRRQARKEVQQKKATKK 2 VGHKLGE P R R +++ K TK+ Sbjct: 67 VGHKLGEFAPTRTFRGHIKKDKKTKR 92 >ref|YP_009019367.1| ribosomal protein S19 (chloroplast) [Auxenochlorella protothecoides] gi|490344849|gb|AGL10892.1| ribosomal protein S19 (chloroplast) [Auxenochlorella protothecoides] gi|511262481|gb|AGN72467.1| ribosomal protein S19 (chloroplast) [Auxenochlorella protothecoides] Length = 92 Score = 111 bits (277), Expect = 2e-22 Identities = 49/86 (56%), Positives = 67/86 (77%) Frame = -3 Query: 259 RIPFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQM 80 +IPFVANHL KKI +LN + +K ++KTWSR STI+P M+GH IAV+NG++H+P I++QM Sbjct: 7 KIPFVANHLFKKIERLNSQGKKKVVKTWSRASTIVPLMIGHTIAVHNGRQHIPLFITDQM 66 Query: 79 VGHKLGELRPRRQARKEVQQKKATKK 2 VGHKLGE P R + V++ K TK+ Sbjct: 67 VGHKLGEFAPTRTFKGHVKKDKKTKR 92 >ref|WP_006515911.1| 30S ribosomal protein S19 [Leptolyngbya sp. PCC 7375] gi|425760663|gb|EKV01516.1| SSU ribosomal protein S19P [Leptolyngbya sp. PCC 7375] Length = 92 Score = 111 bits (277), Expect = 2e-22 Identities = 50/84 (59%), Positives = 65/84 (77%) Frame = -3 Query: 253 PFVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVG 74 PFVA+HL++KI +LN K +K +IKTWSR STIIP+M+GH IAV+NG++HVP +SEQMVG Sbjct: 9 PFVADHLLRKIEKLNAKGDKQVIKTWSRASTIIPQMIGHTIAVHNGRQHVPVYVSEQMVG 68 Query: 73 HKLGELRPRRQARKEVQQKKATKK 2 HKLGE P R R V+ K ++ Sbjct: 69 HKLGEFAPTRTFRGHVKSDKKARR 92 >ref|WP_038061668.1| 30S ribosomal protein S19 [Thermus filiformis] gi|760488099|gb|KIX84409.1| 30S ribosomal protein S19 [Thermus filiformis] Length = 93 Score = 110 bits (276), Expect = 3e-22 Identities = 53/83 (63%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ LNQK EK +IKTWSR STI+PEMVGH IAVYNGK+H+P I+E MVGH Sbjct: 10 FVDDHLLEKVLLLNQKGEKRVIKTWSRRSTIVPEMVGHTIAVYNGKQHIPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92 >ref|WP_028493563.1| 30S ribosomal protein S19 [Thermus antranikianii] Length = 93 Score = 110 bits (276), Expect = 3e-22 Identities = 53/83 (63%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ +LN K EK LIKTWSR STI+PEMVGH IAVYNG++HVP I+E MVGH Sbjct: 10 FVDDHLLRKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGRQHVPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92 >ref|WP_018111295.1| 30S ribosomal protein S19 [Thermus igniterrae] Length = 93 Score = 110 bits (275), Expect = 4e-22 Identities = 53/83 (63%), Positives = 64/83 (77%) Frame = -3 Query: 250 FVANHLVKKISQLNQKAEKDLIKTWSRGSTIIPEMVGHRIAVYNGKKHVPFRISEQMVGH 71 FV +HL++K+ +LN + EK LIKTWSR STI+PEMVGH IAVYNGK+HVP I+E MVGH Sbjct: 10 FVDDHLLEKVLELNARGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGH 69 Query: 70 KLGELRPRRQARKEVQQKKATKK 2 KLGE P R R ++ KATKK Sbjct: 70 KLGEFAPTRTYRGHGKEAKATKK 92