BLASTX nr result
ID: Forsythia22_contig00000792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00000792 (629 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36588.1| hypothetical protein MIMGU_mgv1a017608mg [Erythra... 60 1e-06 >gb|EYU36588.1| hypothetical protein MIMGU_mgv1a017608mg [Erythranthe guttata] Length = 54 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 435 MLLGVLKGEPLVTKLAKVAKYGVLPGAMIAALV 337 M+LGVLKGEPL+TKLA +AKYGVLPGAMIAAL+ Sbjct: 1 MVLGVLKGEPLITKLAALAKYGVLPGAMIAALI 33