BLASTX nr result
ID: Forsythia22_contig00000583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00000583 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094299.1| PREDICTED: 40S ribosomal protein S14-3-like ... 127 3e-27 ref|XP_011077844.1| PREDICTED: 40S ribosomal protein S14-3 [Sesa... 127 3e-27 ref|XP_009601009.1| PREDICTED: 40S ribosomal protein S14-2 [Nico... 126 6e-27 ref|XP_009601549.1| PREDICTED: 40S ribosomal protein S14-2 [Nico... 123 4e-26 emb|CDP16098.1| unnamed protein product [Coffea canephora] 122 9e-26 ref|XP_006339137.1| PREDICTED: 40S ribosomal protein S14-2-like ... 122 9e-26 gb|EPS65680.1| hypothetical protein M569_09096 [Genlisea aurea] 121 2e-25 ref|XP_004246490.1| PREDICTED: 40S ribosomal protein S14-2-like ... 121 2e-25 ref|XP_012836140.1| PREDICTED: 40S ribosomal protein S14 [Erythr... 121 2e-25 ref|XP_012839738.1| PREDICTED: 40S ribosomal protein S14 [Erythr... 121 2e-25 ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [B... 120 3e-25 ref|NP_001274895.1| 40S ribosomal protein S14-2-like [Solanum tu... 120 4e-25 emb|CDP12343.1| unnamed protein product [Coffea canephora] 120 5e-25 ref|XP_006430156.1| hypothetical protein CICLE_v10013022mg [Citr... 120 5e-25 ref|XP_012072103.1| PREDICTED: 40S ribosomal protein S14-3 isofo... 119 6e-25 gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] 119 6e-25 ref|XP_012839737.1| PREDICTED: 40S ribosomal protein S14-like [E... 119 8e-25 ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Popu... 119 8e-25 ref|XP_004966229.1| PREDICTED: 40S ribosomal protein S14 [Setari... 119 8e-25 ref|XP_006369385.1| hypothetical protein POPTR_0001s22620g [Popu... 119 8e-25 >ref|XP_011094299.1| PREDICTED: 40S ribosomal protein S14-3-like [Sesamum indicum] Length = 150 Score = 127 bits (319), Expect = 3e-27 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGPATRDGE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSKRRTREPKEENVTLGPATRDGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_011077844.1| PREDICTED: 40S ribosomal protein S14-3 [Sesamum indicum] Length = 150 Score = 127 bits (319), Expect = 3e-27 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGPATRDGE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSKRRTREPKEENVTLGPATRDGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_009601009.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana tomentosiformis] Length = 184 Score = 126 bits (316), Expect = 6e-27 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = -3 Query: 205 ELTKDMSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRI 26 ++ ++MSKRRTREPKEE VTLGPATR+GE+VFGVAHIFASFNDTFIHVTDLSGRETMVRI Sbjct: 30 QINRNMSKRRTREPKEETVTLGPATREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRI 89 Query: 25 TGGMKVKA 2 TGGMKVKA Sbjct: 90 TGGMKVKA 97 >ref|XP_009601549.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana tomentosiformis] gi|698478856|ref|XP_009786558.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana sylvestris] gi|698518200|ref|XP_009803980.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana sylvestris] Length = 150 Score = 123 bits (309), Expect = 4e-26 Identities = 60/63 (95%), Positives = 62/63 (98%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEE VTLGPATR+GE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSKRRTREPKEETVTLGPATREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >emb|CDP16098.1| unnamed protein product [Coffea canephora] Length = 219 Score = 122 bits (306), Expect = 9e-26 Identities = 60/63 (95%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGPA RDGE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 70 MSKRRTREPKEENVTLGPAVRDGEQVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 129 Query: 10 VKA 2 VKA Sbjct: 130 VKA 132 >ref|XP_006339137.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum tuberosum] gi|565348159|ref|XP_006341085.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum tuberosum] Length = 150 Score = 122 bits (306), Expect = 9e-26 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKR+TREPKEE VTLGPATR+GE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSKRKTREPKEETVTLGPATREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >gb|EPS65680.1| hypothetical protein M569_09096 [Genlisea aurea] Length = 200 Score = 121 bits (304), Expect = 2e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGPA RDGE+VFGVAHIFASFNDTFIHVTDLSG ET+VR+TGGMK Sbjct: 51 MSKRRTREPKEENVTLGPAARDGELVFGVAHIFASFNDTFIHVTDLSGMETLVRVTGGMK 110 Query: 10 VKA 2 VKA Sbjct: 111 VKA 113 >ref|XP_004246490.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum lycopersicum] gi|460407996|ref|XP_004249434.1| PREDICTED: 40S ribosomal protein S14-2 [Solanum lycopersicum] gi|697164066|ref|XP_009590855.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana tomentosiformis] gi|698519824|ref|XP_009804783.1| PREDICTED: 40S ribosomal protein S14-2 [Nicotiana sylvestris] gi|82623419|gb|ABB87124.1| hypothetical protein [Solanum tuberosum] gi|83284009|gb|ABC01912.1| ribosomal protein S14-like protein [Solanum tuberosum] Length = 150 Score = 121 bits (303), Expect = 2e-25 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+TREPKEE VTLGPATR+GE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSRRKTREPKEETVTLGPATREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_012836140.1| PREDICTED: 40S ribosomal protein S14 [Erythranthe guttatus] gi|604334571|gb|EYU38655.1| hypothetical protein MIMGU_mgv1a015661mg [Erythranthe guttata] Length = 150 Score = 121 bits (303), Expect = 2e-25 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+TREPKEEN+TLGPATRDGE+VF VAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSRRKTREPKEENITLGPATRDGELVFCVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_012839738.1| PREDICTED: 40S ribosomal protein S14 [Erythranthe guttatus] gi|604330490|gb|EYU35518.1| hypothetical protein MIMGU_mgv1a015646mg [Erythranthe guttata] Length = 150 Score = 121 bits (303), Expect = 2e-25 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+TREPKEENVTLGPATRDGE+VF VAH+FASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSRRKTREPKEENVTLGPATRDGELVFCVAHVFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [Brachypodium distachyon] Length = 150 Score = 120 bits (302), Expect = 3e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKR+TREPKEENVTLGPA R+GE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSKRKTREPKEENVTLGPAVREGEFVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|NP_001274895.1| 40S ribosomal protein S14-2-like [Solanum tuberosum] gi|460374632|ref|XP_004233114.1| PREDICTED: 40S ribosomal protein S14-2 isoform X1 [Solanum lycopersicum] gi|77745450|gb|ABB02624.1| ribosomal protein S14-like [Solanum tuberosum] Length = 150 Score = 120 bits (301), Expect = 4e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEE VTLGP+ R+GE+VFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSKRRTREPKEETVTLGPSVREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >emb|CDP12343.1| unnamed protein product [Coffea canephora] Length = 154 Score = 120 bits (300), Expect = 5e-25 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = -3 Query: 187 SKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMKV 8 SKRR REPKEENVTLGPATRDGE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMKV Sbjct: 6 SKRRQREPKEENVTLGPATRDGEQVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKV 65 Query: 7 KA 2 KA Sbjct: 66 KA 67 >ref|XP_006430156.1| hypothetical protein CICLE_v10013022mg [Citrus clementina] gi|568856342|ref|XP_006481743.1| PREDICTED: 40S ribosomal protein S14-3-like [Citrus sinensis] gi|557532213|gb|ESR43396.1| hypothetical protein CICLE_v10013022mg [Citrus clementina] gi|641851614|gb|KDO70484.1| hypothetical protein CISIN_1g031952mg [Citrus sinensis] Length = 150 Score = 120 bits (300), Expect = 5e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+TREPKEENVTLGPA RDGE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSRRKTREPKEENVTLGPAVRDGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_012072103.1| PREDICTED: 40S ribosomal protein S14-3 isoform X1 [Jatropha curcas] gi|643730539|gb|KDP37971.1| hypothetical protein JCGZ_04614 [Jatropha curcas] Length = 150 Score = 119 bits (299), Expect = 6e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKR+TREPKEENVTLGPA R+GE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSKRKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] Length = 150 Score = 119 bits (299), Expect = 6e-25 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+TREPKEENVTLGPA RDGE VFGVAH+FASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSRRKTREPKEENVTLGPAVRDGEHVFGVAHVFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_012839737.1| PREDICTED: 40S ribosomal protein S14-like [Erythranthe guttatus] gi|604330491|gb|EYU35519.1| hypothetical protein MIMGU_mgv1a015653mg [Erythranthe guttata] Length = 150 Score = 119 bits (298), Expect = 8e-25 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MS+R+ REPKEENVTLGPATRDGE+VF VAH+FASFNDTFIHVTDLSGRETMVRITGGMK Sbjct: 1 MSRRKVREPKEENVTLGPATRDGELVFCVAHVFASFNDTFIHVTDLSGRETMVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] gi|550347908|gb|EEE84586.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] Length = 133 Score = 119 bits (298), Expect = 8e-25 Identities = 58/63 (92%), Positives = 60/63 (95%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGP R+GE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSKRRTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_004966229.1| PREDICTED: 40S ribosomal protein S14 [Setaria italica] Length = 150 Score = 119 bits (298), Expect = 8e-25 Identities = 57/63 (90%), Positives = 60/63 (95%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKR+TREPKEENVTLGP R+GE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSKRKTREPKEENVTLGPTVREGEFVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63 >ref|XP_006369385.1| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] gi|743923912|ref|XP_011006063.1| PREDICTED: 40S ribosomal protein S14 [Populus euphratica] gi|743931459|ref|XP_011010001.1| PREDICTED: 40S ribosomal protein S14 [Populus euphratica] gi|118481419|gb|ABK92652.1| unknown [Populus trichocarpa] gi|550347907|gb|ERP65954.1| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] Length = 150 Score = 119 bits (298), Expect = 8e-25 Identities = 58/63 (92%), Positives = 60/63 (95%) Frame = -3 Query: 190 MSKRRTREPKEENVTLGPATRDGEIVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMK 11 MSKRRTREPKEENVTLGP R+GE VFGVAHIFASFNDTFIHVTDLSGRET+VRITGGMK Sbjct: 1 MSKRRTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK 60 Query: 10 VKA 2 VKA Sbjct: 61 VKA 63