BLASTX nr result
ID: Forsythia21_contig00063210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00063210 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 65 2e-08 gb|ABQ14858.1| Ycf2 [Kalanchoe daigremontiana] 65 2e-08 ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 64 3e-08 ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 64 3e-08 ref|YP_004465231.1| hypothetical chloroplast RF21 [Jacobaea vulg... 64 3e-08 ref|YP_004286046.1| hypothetical chloroplast RF21 [Gossypium thu... 64 3e-08 ref|YP_009144690.1| hypothetical chloroplast RF2 (chloroplast) [... 64 4e-08 ref|YP_009144558.1| Ycf2 (chloroplast) [Rosmarinus officinalis] ... 64 4e-08 ref|YP_009115939.1| hypothetical chloroplast RF2 [Scrophularia t... 64 4e-08 gb|ADD30879.1| putative RF2 protein (chloroplast) [Antirrhinum m... 64 4e-08 ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795... 64 4e-08 ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 64 4e-08 gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulga... 64 4e-08 ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 64 4e-08 ref|YP_004940552.1| ycf2 gene product (chloroplast) [Boea hygrom... 64 4e-08 ref|YP_004935710.1| ycf2 gene product (chloroplast) [Sesamum ind... 64 4e-08 ref|YP_009154830.1| hypothetical chloroplast RF21 (chloroplast) ... 64 5e-08 ref|YP_009142368.1| hypothetical chloroplast RF21 (chloroplast) ... 64 5e-08 ref|YP_009139832.1| hypothetical chloroplast RF21 (chloroplast) ... 64 5e-08 ref|YP_009139509.1| hypothetical chloroplast RF21 (chloroplast) ... 64 5e-08 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINNQNMVER N+YL LL +PMN IGPRN TLEESVGSS Sbjct: 91 RINNQNMVERKNLYLRGLLPIPMNSIGPRNGTLEESVGSS 130 >gb|ABQ14858.1| Ycf2 [Kalanchoe daigremontiana] Length = 2271 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINNQNMVER NIYL+ LL +PMN IGPRN+TLEES GSS Sbjct: 91 RINNQNMVERKNIYLTGLLPIPMNSIGPRNDTLEESFGSS 130 >ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882189|emb|CDL78862.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLKGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882181|emb|CDL78854.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLKGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_004465231.1| hypothetical chloroplast RF21 [Jacobaea vulgaris] gi|334702389|ref|YP_004465251.1| hypothetical chloroplast RF21 [Jacobaea vulgaris] gi|308156127|gb|ADO15455.1| hypothetical chloroplast RF21 [Jacobaea vulgaris] gi|308156147|gb|ADO15475.1| hypothetical chloroplast RF21 [Jacobaea vulgaris] Length = 2216 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER NIYL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNIYLIGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_004286046.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|325210992|ref|YP_004286065.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|290775831|gb|ADD62327.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|290775854|gb|ADD62350.1| hypothetical chloroplast RF21 [Gossypium thurberi] Length = 2298 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINNQNMVER N+YL+ LL +PMN IGPRN+TLEES GSS Sbjct: 91 RINNQNMVERKNLYLTGLLPIPMNSIGPRNDTLEESFGSS 130 >ref|YP_009144690.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|836643486|ref|YP_009144671.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345826|gb|AKJ77127.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345827|gb|AKJ77128.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] Length = 2289 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_009144558.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|836643371|ref|YP_009144577.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|827345130|gb|AKJ76714.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|827345131|gb|AKJ76715.1| Ycf2 (chloroplast) [Rosmarinus officinalis] Length = 2277 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_009115939.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|752789749|ref|YP_009115959.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|744673783|gb|AJD00768.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|744673804|gb|AJD00789.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] Length = 2282 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >gb|ADD30879.1| putative RF2 protein (chloroplast) [Antirrhinum majus] gi|340807055|gb|AEK71663.1| hypothetical chloroplast RF2 [Antirrhinum majus] Length = 2274 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795030|ref|YP_003359421.1| Ycf2 (chloroplast) [Olea europaea] gi|281428729|gb|ADA69968.1| Ycf2 (chloroplast) [Olea europaea] gi|281428749|gb|ADA69988.1| Ycf2 (chloroplast) [Olea europaea] gi|291059296|gb|ADD72132.1| hypothetical chloroplast RF21 [Olea europaea] gi|291059317|gb|ADD72153.1| hypothetical chloroplast RF21 [Olea europaea] Length = 2277 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|568247135|ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697199|gb|AHA84954.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697206|gb|AHA84961.1| hypothetical chloroplast RF2 [Ajuga reptans] Length = 2248 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176216|gb|AFV61875.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 2261 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|573461995|emb|CCQ71664.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] gi|573462016|emb|CCQ71685.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_004940552.1| ycf2 gene product (chloroplast) [Boea hygrometrica] gi|364284047|ref|YP_004940572.1| ycf2 gene product (chloroplast) [Boea hygrometrica] gi|340549450|gb|AEK53272.1| hypothetical chloroplast RF21 (chloroplast) [Boea hygrometrica] gi|340549470|gb|AEK53292.1| hypothetical chloroplast RF21 (chloroplast) [Boea hygrometrica] Length = 2274 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_004935710.1| ycf2 gene product (chloroplast) [Sesamum indicum] gi|359422324|ref|YP_004935729.1| ycf2 gene product (chloroplast) [Sesamum indicum] gi|347448339|gb|AEO92750.1| ycf2 (chloroplast) [Sesamum indicum] gi|347448358|gb|AEO92769.1| ycf2 (chloroplast) [Sesamum indicum] gi|496538644|gb|AGL45379.1| ribosomal protein L23 (chloroplast) [Sesamum indicum] gi|496538663|gb|AGL45398.1| Ycf2 (chloroplast) [Sesamum indicum] Length = 2097 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 92 RINNRNMVERKNLYLRGLLPIPMNSIGPRNDTLEESVGSS 131 >ref|YP_009154830.1| hypothetical chloroplast RF21 (chloroplast) [Aster spathulifolius] gi|885001568|ref|YP_009154850.1| hypothetical chloroplast RF21 (chloroplast) [Aster spathulifolius] gi|549533559|gb|AGX29651.1| hypothetical chloroplast RF21 (chloroplast) [Aster spathulifolius] gi|549533580|gb|AGX29672.1| hypothetical chloroplast RF21 (chloroplast) [Aster spathulifolius] Length = 2216 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLIGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_009142368.1| hypothetical chloroplast RF21 (chloroplast) [Iochroma tingoanum] gi|827046076|ref|YP_009142388.1| hypothetical chloroplast RF21 (chloroplast) [Iochroma tingoanum] gi|820957855|gb|AKH02360.1| hypothetical chloroplast RF21 (chloroplast) [Iochroma tingoanum] gi|820957875|gb|AKH02380.1| hypothetical chloroplast RF21 (chloroplast) [Iochroma tingoanum] Length = 2276 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 87 RINNRNMVERKNLYLIGLLPIPMNSIGPRNDTLEESVGSS 126 >ref|YP_009139832.1| hypothetical chloroplast RF21 (chloroplast) [Cynara humilis] gi|821318732|ref|YP_009139851.1| hypothetical chloroplast RF21 (chloroplast) [Cynara humilis] gi|819231943|gb|AKG49840.1| hypothetical chloroplast RF21 (chloroplast) [Cynara humilis] gi|819231963|gb|AKG49860.1| hypothetical chloroplast RF21 (chloroplast) [Cynara humilis] Length = 2281 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 91 RINNRNMVERKNLYLIGLLPIPMNSIGPRNDTLEESVGSS 130 >ref|YP_009139509.1| hypothetical chloroplast RF21 (chloroplast) [Dunalia solanacea] gi|821318392|ref|YP_009139527.1| hypothetical chloroplast RF21 (chloroplast) [Dunalia solanacea] gi|817597892|gb|AKF78452.1| hypothetical chloroplast RF21 (chloroplast) [Dunalia solanacea] gi|817597910|gb|AKF78470.1| hypothetical chloroplast RF21 (chloroplast) [Dunalia solanacea] Length = 2276 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 155 RINNQNMVER*NIYLSELLRVPMNFIGPRNNTLEESVGSS 274 RINN+NMVER N+YL LL +PMN IGPRN+TLEESVGSS Sbjct: 87 RINNRNMVERKNLYLIGLLPIPMNSIGPRNDTLEESVGSS 126