BLASTX nr result
ID: Forsythia21_contig00063144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00063144 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06789.1| unnamed protein product [Coffea canephora] 72 1e-10 >emb|CDP06789.1| unnamed protein product [Coffea canephora] Length = 441 Score = 72.0 bits (175), Expect = 1e-10 Identities = 38/96 (39%), Positives = 56/96 (58%) Frame = +1 Query: 4 ESRKIKKISIHQDERKSLLVEKLKSRDRNCYMCLAAYFIDDTWKLKRWVLVVWNATGYNL 183 E KIK + + D + +L VE LK+ +CL A+F+DDTWK K+WVL + Sbjct: 161 EMMKIKHVLRNMDAKVNLSVEMLKNDAFGDILCLTAHFVDDTWKWKKWVLRFQVLNWESY 220 Query: 184 SDAVLKSLNYWNIEGKISSITFKIGIDIGETVDKVK 291 S A++KSL YW I K+ +IT K I ET++ ++ Sbjct: 221 SGAIVKSLEYWGIMDKVFAITVKSDIFDAETLEWIQ 256