BLASTX nr result
ID: Forsythia21_contig00062938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062938 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] 69 1e-09 gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum an... 62 2e-07 >gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] Length = 173 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 164 RERYFPFGLVVGEKKFEPSTLWFVATCSNLLSY*PHPVSTG 42 RERYFPFG VVGE+ FEP T WFVAT SN LSY PHPVSTG Sbjct: 4 RERYFPFGPVVGEEGFEPPTPWFVATRSNPLSYRPHPVSTG 44 >gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 115 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +3 Query: 18 F*GALANKSS*DRVWLVAQKIRACGYEPQCRRFKFLLTHNQSKRKIPFPL 167 F G N+SS D V VAQ+IRA GYEP+CR F+ LL HN+ KR++PFPL Sbjct: 61 FEGTPGNRSSGDGVGPVAQRIRARGYEPRCRGFESLLAHNRPKREVPFPL 110