BLASTX nr result
ID: Forsythia21_contig00062812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062812 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010920050.1| PREDICTED: ruBisCO large subunit-binding pro... 57 6e-06 ref|XP_010920048.1| PREDICTED: ruBisCO large subunit-binding pro... 57 6e-06 ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding pro... 57 6e-06 >ref|XP_010920050.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, chloroplastic isoform X2 [Elaeis guineensis] Length = 604 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 141 NVASVARTFLTSDAMVLDIKDPEPVAAGNLMDDSG 37 + ASVARTFLTSD +V+DIK+PEP AGNLMD+SG Sbjct: 567 HAASVARTFLTSDVVVVDIKEPEPAPAGNLMDNSG 601 >ref|XP_010920048.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, chloroplastic isoform X1 [Elaeis guineensis] gi|743779170|ref|XP_010920049.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, chloroplastic isoform X1 [Elaeis guineensis] Length = 611 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 141 NVASVARTFLTSDAMVLDIKDPEPVAAGNLMDDSG 37 + ASVARTFLTSD +V+DIK+PEP AGNLMD+SG Sbjct: 574 HAASVARTFLTSDVVVVDIKEPEPAPAGNLMDNSG 608 >ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, chloroplastic [Vitis vinifera] gi|731402352|ref|XP_010654639.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, chloroplastic [Vitis vinifera] gi|297743227|emb|CBI36094.3| unnamed protein product [Vitis vinifera] Length = 609 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 141 NVASVARTFLTSDAMVLDIKDPEPVAAGNLMDDSG 37 + ASVARTFLTSDA+V+DIK+PEP+ AGN MD+SG Sbjct: 572 HAASVARTFLTSDAVVVDIKEPEPIPAGNPMDNSG 606