BLASTX nr result
ID: Forsythia21_contig00062578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062578 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855370.1| PREDICTED: uncharacterized protein LOC105974... 57 4e-06 emb|CDP00204.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_012855370.1| PREDICTED: uncharacterized protein LOC105974767 [Erythranthe guttatus] gi|604302943|gb|EYU22468.1| hypothetical protein MIMGU_mgv1a015144mg [Erythranthe guttata] Length = 167 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/73 (43%), Positives = 42/73 (57%) Frame = -3 Query: 219 MASLCTLIPVTLFPLPTAVPAKNPTFHGTILRTPILILRTRPLLFPAKILSRALNATQPQ 40 MASLC I LFP PTA+PA+ G+ILRT + P F A+I +A N+ Q Sbjct: 1 MASLCNPI---LFP-PTAIPAQTSISGGSILRTAFFVQHAPPTFFTARISPKAPNSVLGQ 56 Query: 39 SYTYPDPIPEFSA 1 + YP P P+F+A Sbjct: 57 KFVYPGPAPDFAA 69 >emb|CDP00204.1| unnamed protein product [Coffea canephora] Length = 125 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/73 (46%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = -3 Query: 219 MASLCTLIPVTLFPLPTAVPAKNPTFHGTILRTPILILRTRPLLFPAKILSRA-LNATQP 43 MA T++ T P P +PAK+ ILRT I RT PLLF A +S L A P Sbjct: 1 MAQTTTILSPTATPKP--IPAKHTVRSNLILRTLCTIPRTHPLLFCANAISATPLRANPP 58 Query: 42 QSYTYPDPIPEFS 4 Q Y YPDP PEF+ Sbjct: 59 QKYIYPDPNPEFA 71