BLASTX nr result
ID: Forsythia21_contig00062528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062528 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367379.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 90 7e-16 emb|CDP20950.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_007210831.1| hypothetical protein PRUPE_ppa017808mg [Prun... 80 4e-13 gb|KHN48688.1| hypothetical protein glysoja_015836 [Glycine soja] 80 7e-13 gb|KHN18553.1| hypothetical protein glysoja_006966 [Glycine soja] 77 6e-12 gb|KDO55565.1| hypothetical protein CISIN_1g039594mg [Citrus sin... 77 6e-12 ref|XP_006440599.1| hypothetical protein CICLE_v10023845mg [Citr... 75 2e-11 gb|KHN32527.1| hypothetical protein glysoja_041263 [Glycine soja] 74 3e-11 ref|XP_010091520.1| hypothetical protein L484_015947 [Morus nota... 72 1e-10 ref|XP_007155310.1| hypothetical protein PHAVU_003G190100g [Phas... 70 5e-10 ref|XP_007138182.1| hypothetical protein PHAVU_009G187200g [Phas... 67 5e-09 ref|XP_002514759.1| conserved hypothetical protein [Ricinus comm... 67 6e-09 gb|KHN30843.1| hypothetical protein glysoja_034867 [Glycine soja] 66 1e-08 gb|KJB50916.1| hypothetical protein B456_008G193000 [Gossypium r... 59 1e-06 gb|KDP31253.1| hypothetical protein JCGZ_11629 [Jatropha curcas] 59 1e-06 >ref|XP_006367379.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 45-like [Solanum tuberosum] Length = 94 Score = 89.7 bits (221), Expect = 7e-16 Identities = 47/81 (58%), Positives = 56/81 (69%) Frame = -2 Query: 245 MSSSASRVIFLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDL 66 M + RV+FL++ C G S Q ERVS RSIDLALRWG + LRSSR+LKA +QDL Sbjct: 1 MLCPSCRVMFLIL-CIGFLSTQPERVSALRSIDLALRWGEDNLFHLRSSRILKAAVVQDL 59 Query: 65 SVTLDIAPSPGMAFDPNQSEK 3 L+IAP+P M FDPNQS K Sbjct: 60 QTQLNIAPAPSMTFDPNQSNK 80 >emb|CDP20950.1| unnamed protein product [Coffea canephora] Length = 94 Score = 84.7 bits (208), Expect = 2e-14 Identities = 46/81 (56%), Positives = 58/81 (71%) Frame = -2 Query: 245 MSSSASRVIFLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDL 66 MS S+ R+I L++ C G F Q E+VSG RSIDLALR GE+L LRSSR+L +VA + L Sbjct: 1 MSFSSCRMIILIV-CIGSFCFQPEKVSGLRSIDLALRLHEGELLFLRSSRILNSVASEGL 59 Query: 65 SVTLDIAPSPGMAFDPNQSEK 3 V L++AP+P FDPNQS K Sbjct: 60 HVQLNLAPAPATMFDPNQSNK 80 >ref|XP_007210831.1| hypothetical protein PRUPE_ppa017808mg [Prunus persica] gi|462406566|gb|EMJ12030.1| hypothetical protein PRUPE_ppa017808mg [Prunus persica] Length = 94 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/76 (52%), Positives = 54/76 (71%) Frame = -2 Query: 230 SRVIFLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLD 51 S V+F+ C G ++Q E+VSG RS+DLALRW +G M L+S ++KAVA++DL L Sbjct: 8 SAVLFV---CIGFLALQPEKVSGLRSMDLALRWDKGHMSFLKSLHLVKAVAVEDLQAKLS 64 Query: 50 IAPSPGMAFDPNQSEK 3 +AP+P M FDPNQS K Sbjct: 65 LAPAPSMTFDPNQSNK 80 >gb|KHN48688.1| hypothetical protein glysoja_015836 [Glycine soja] Length = 94 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/72 (52%), Positives = 52/72 (72%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F+V+ C G+ + Q +VSG RS DLALRW G + +RS R+LKAVA++DL +++AP+ Sbjct: 9 FIVLVCVGILASQPFKVSGLRSKDLALRWDEGLLPFVRSFRILKAVAVEDLQSKVELAPA 68 Query: 38 PGMAFDPNQSEK 3 P M FDPNQS K Sbjct: 69 PSMTFDPNQSNK 80 >gb|KHN18553.1| hypothetical protein glysoja_006966 [Glycine soja] Length = 94 Score = 76.6 bits (187), Expect = 6e-12 Identities = 38/72 (52%), Positives = 49/72 (68%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F V+ C G+ + Q +VSG RS DLALRW G + +RS RVLKA A++D +++APS Sbjct: 9 FFVLVCVGILASQPFKVSGLRSKDLALRWDEGLLPFVRSFRVLKAEAVEDFQSKVELAPS 68 Query: 38 PGMAFDPNQSEK 3 P M FDPNQS K Sbjct: 69 PSMTFDPNQSNK 80 >gb|KDO55565.1| hypothetical protein CISIN_1g039594mg [Citrus sinensis] Length = 94 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/72 (48%), Positives = 51/72 (70%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F+++ C G S+Q + VSG RSIDL LRW + + +R++R+LKAV L+DL + +AP+ Sbjct: 9 FILLVCIGFLSLQPQNVSGLRSIDLVLRWDKEVLPAVRNTRILKAVPLKDLQMNPSLAPA 68 Query: 38 PGMAFDPNQSEK 3 P + FDPNQS K Sbjct: 69 PSLMFDPNQSNK 80 >ref|XP_006440599.1| hypothetical protein CICLE_v10023845mg [Citrus clementina] gi|557542861|gb|ESR53839.1| hypothetical protein CICLE_v10023845mg [Citrus clementina] Length = 94 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/72 (47%), Positives = 50/72 (69%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F+++ C G S+Q + VSG RSID LRW + + +R++R+LKAV L+DL + +AP+ Sbjct: 9 FILLVCIGFLSLQPQNVSGLRSIDFVLRWDKEVLPAVRNTRILKAVPLKDLQMNPSLAPA 68 Query: 38 PGMAFDPNQSEK 3 P + FDPNQS K Sbjct: 69 PSLMFDPNQSNK 80 >gb|KHN32527.1| hypothetical protein glysoja_041263 [Glycine soja] Length = 95 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/72 (50%), Positives = 49/72 (68%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F V+ C G+ + Q VSG+RS DLALRW + + R +RV+K VA++DL L++AP+ Sbjct: 10 FFVLVCVGILASQPCMVSGQRSKDLALRWDHKQSPLARIARVVKGVAMEDLQSQLELAPA 69 Query: 38 PGMAFDPNQSEK 3 P M FDPNQS K Sbjct: 70 PSMTFDPNQSNK 81 >ref|XP_010091520.1| hypothetical protein L484_015947 [Morus notabilis] gi|587854650|gb|EXB44690.1| hypothetical protein L484_015947 [Morus notabilis] Length = 97 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -2 Query: 215 LVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPSP 36 L++FC VF+++ + VS RS DLALRW + ++ L K+VAL+DL LD+AP+P Sbjct: 13 LLLFCVVVFALRPQNVSALRSKDLALRWDKAKLPFLGDVHFFKSVALEDLERKLDLAPAP 72 Query: 35 GMAFDPNQSEK 3 M FDPNQS K Sbjct: 73 SMTFDPNQSNK 83 >ref|XP_007155310.1| hypothetical protein PHAVU_003G190100g [Phaseolus vulgaris] gi|561028664|gb|ESW27304.1| hypothetical protein PHAVU_003G190100g [Phaseolus vulgaris] Length = 95 Score = 70.1 bits (170), Expect = 5e-10 Identities = 37/73 (50%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAV-ALQDLSVTLDIAP 42 F V+ C G+ + Q +VSG RS DLALRW G + +RS RVLKAV A++DL +++AP Sbjct: 9 FFVLVCVGILASQPFKVSGFRSKDLALRWDEGLLPFVRSFRVLKAVYAVEDLHSKVELAP 68 Query: 41 SPGMAFDPNQSEK 3 +P M DPN+S K Sbjct: 69 APSMTIDPNRSNK 81 >ref|XP_007138182.1| hypothetical protein PHAVU_009G187200g [Phaseolus vulgaris] gi|561011269|gb|ESW10176.1| hypothetical protein PHAVU_009G187200g [Phaseolus vulgaris] Length = 95 Score = 67.0 bits (162), Expect = 5e-09 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRS-SRVLKAVALQDLSVTLDIAP 42 F V+ C G+ + Q VSG RS DLAL+W + L ++ LKAVA++DL LD+AP Sbjct: 9 FFVLVCVGILASQPGMVSGLRSKDLALKWDHRQSTPLAQIAQDLKAVAMEDLQSQLDLAP 68 Query: 41 SPGMAFDPNQSEK 3 +P + FDPNQS K Sbjct: 69 APSLTFDPNQSNK 81 >ref|XP_002514759.1| conserved hypothetical protein [Ricinus communis] gi|223546363|gb|EEF47865.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 66.6 bits (161), Expect = 6e-09 Identities = 36/72 (50%), Positives = 45/72 (62%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 FL++ C G S Q E+VS SIDLALR + + V ++SR+L VAL DL AP+ Sbjct: 41 FLLLLCIGYLSFQPEKVSSLTSIDLALRLKQELLPVAQNSRMLTTVALDDLQTFTSSAPA 100 Query: 38 PGMAFDPNQSEK 3 P M FDPNQS K Sbjct: 101 PSMVFDPNQSNK 112 >gb|KHN30843.1| hypothetical protein glysoja_034867 [Glycine soja] Length = 96 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPS 39 F V+ C G+ + Q VSG RS DLA RW + + R +RV+K VA++DL L++AP+ Sbjct: 10 FFVLLCVGMLASQPCMVSGLRSKDLAQRWDHKQSPLARIARVVKGVAIEDLQSQLELAPA 69 Query: 38 PGM-AFDPNQSEK 3 P M FDPNQS K Sbjct: 70 PSMTTFDPNQSNK 82 >gb|KJB50916.1| hypothetical protein B456_008G193000 [Gossypium raimondii] Length = 96 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/73 (39%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Frame = -2 Query: 218 FLVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAV-ALQDLSVTLDIAP 42 F+++ C + Q E VS R IDLAL+W +G ++ +SR+L+AV ++ L +AP Sbjct: 10 FILVSCIALLVFQTEIVSAMRGIDLALKWDKGLSPLVENSRILRAVGSVDSLQTPPSLAP 69 Query: 41 SPGMAFDPNQSEK 3 +P + FDPN+S K Sbjct: 70 APSIMFDPNRSNK 82 >gb|KDP31253.1| hypothetical protein JCGZ_11629 [Jatropha curcas] Length = 94 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = -2 Query: 215 LVIFCGGVFSIQLERVSGRRSIDLALRWGRGEMLVLRSSRVLKAVALQDLSVTLDIAPSP 36 L++ C G S Q +VS SIDLALR+ + + ++SR+L +V ++DL AP+P Sbjct: 10 LLLLCIGYLSFQPYKVSSLTSIDLALRFKQELLPFAQNSRLLTSVVVKDLQTLASSAPAP 69 Query: 35 GMAFDPNQSEK 3 M FDPNQS K Sbjct: 70 SMVFDPNQSNK 80