BLASTX nr result
ID: Forsythia21_contig00062425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062425 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Ses... 61 3e-07 ref|XP_012847531.1| PREDICTED: metalloendoproteinase 1 [Erythran... 57 5e-06 >ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum] Length = 373 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -2 Query: 282 RKVELANDDIMGIQELYGSSTNNNETNPVLTPRNENEVNGAHNLVRSFCRHGI 124 RKVELANDDIMGIQELYGS+ + N ++P LTPR E + +GA + R GI Sbjct: 308 RKVELANDDIMGIQELYGSNPSYNGSDPTLTPRTEWDTSGAPRVDYLLWRRGI 360 >ref|XP_012847531.1| PREDICTED: metalloendoproteinase 1 [Erythranthe guttatus] gi|604316456|gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata] Length = 374 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 282 RKVELANDDIMGIQELYGSSTNNNETNPVLTPRNENEVNGAHNL 151 RKVELANDDIMGIQELYGS+ N N + LTP E + +GA L Sbjct: 313 RKVELANDDIMGIQELYGSNQNYNGSGQTLTPIGERDTSGAPRL 356