BLASTX nr result
ID: Forsythia21_contig00061113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00061113 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092247.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-... 57 6e-06 >ref|XP_011092247.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Sesamum indicum] Length = 328 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -1 Query: 256 FRESNEKGRFEKVGFTVKDFAG-IGFPM*KPEFG 158 +RESNEKGRFEKVGFTVKDFAG +GFPM K E G Sbjct: 294 YRESNEKGRFEKVGFTVKDFAGVVGFPMPKSENG 327