BLASTX nr result
ID: Forsythia21_contig00059938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00059938 (220 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11414.1| unnamed protein product [Coffea canephora] 65 7e-10 ref|XP_011091991.1| PREDICTED: uncharacterized protein LOC105172... 57 5e-06 >emb|CDP11414.1| unnamed protein product [Coffea canephora] Length = 947 Score = 65.5 bits (158), Expect(2) = 7e-10 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = +3 Query: 48 IQRTPFEALYGTSPPQLALGPYQQTNLAAVEDLLQERYKMNKPLKESLAQASARIK 215 IQ TPFEA+YG +PPQL+ GPY Q +A V D L+ER+K++ LK++L QA R+K Sbjct: 65 IQMTPFEAVYGQAPPQLSRGPYTQAKVAIVGDCLKERHKVDIILKQNLKQAQERMK 120 Score = 24.3 bits (51), Expect(2) = 7e-10 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 3/20 (15%) Frame = +2 Query: 2 RAWAKWILLAEW---STYHT 52 + W W+ +AEW ++YHT Sbjct: 44 KKWNHWLTMAEWWYNTSYHT 63 >ref|XP_011091991.1| PREDICTED: uncharacterized protein LOC105172306 [Sesamum indicum] Length = 1302 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = +3 Query: 45 TIQRTPFEALYGTSPPQLALGPYQQTNLAAVEDLLQERYKMNKPLKESLAQASARIK 215 T + TPF+ +YG P QL++GPY Q++ + V++L+QER K+ + LKE+L QA R+K Sbjct: 1069 TEKATPFQEMYGYPPQQLSIGPYLQSHHSDVKELMQERVKVLQLLKENLQQAQHRMK 1125