BLASTX nr result
ID: Forsythia21_contig00059646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00059646 (475 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099269.1| PREDICTED: BEL1-like homeodomain protein 4 [... 62 2e-07 >ref|XP_011099269.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum] Length = 765 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -3 Query: 170 NMGLAKG-LLPLAKSHFEGPNSIHFLDKEFFLNSMSQNYQQGFFSFTNGFDISQQ 9 +MG+A LLP SH +G NS+ +LDK+ F NSMSQ+Y Q FSF+NGF+ SQQ Sbjct: 2 DMGIATPTLLPSVTSHSKGHNSLQYLDKQNFSNSMSQDYHQSIFSFSNGFERSQQ 56