BLASTX nr result
ID: Forsythia21_contig00058486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00058486 (257 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081315.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_012852793.1| PREDICTED: pentatricopeptide repeat-containi... 115 9e-24 gb|EYU24651.1| hypothetical protein MIMGU_mgv1a022213mg, partial... 115 9e-24 ref|XP_010318779.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 gb|EPS73576.1| hypothetical protein M569_01176, partial [Genlise... 96 7e-18 ref|XP_009630608.1| PREDICTED: pentatricopeptide repeat-containi... 96 9e-18 ref|XP_010654774.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_009802076.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_012073209.1| PREDICTED: pentatricopeptide repeat-containi... 94 5e-17 ref|XP_010691155.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 emb|CDO98138.1| unnamed protein product [Coffea canephora] 92 1e-16 ref|XP_006368374.1| pentatricopeptide repeat-containing family p... 92 2e-16 ref|XP_011016641.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 ref|XP_009348770.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_009339263.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_008243864.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_002517612.1| pentatricopeptide repeat-containing protein,... 85 2e-14 ref|XP_007150739.1| hypothetical protein PHAVU_005G176600g [Phas... 85 2e-14 emb|CBI36298.3| unnamed protein product [Vitis vinifera] 85 2e-14 >ref|XP_011081315.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Sesamum indicum] Length = 642 Score = 117 bits (293), Expect = 3e-24 Identities = 60/85 (70%), Positives = 68/85 (80%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI N+L EC++ EEKLPTREA VIRAYSESG V KALELYSFVLK +NA+P +LACNS Sbjct: 113 EIDNVLLECLQSEEKLPTREALGFVIRAYSESGLVLKALELYSFVLKTYNALPQLLACNS 172 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLNGLV +G +E A VY EMV RD Sbjct: 173 LLNGLVKDGNMEAAWFVYDEMVRRD 197 >ref|XP_012852793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Erythranthe guttatus] Length = 817 Score = 115 bits (289), Expect = 9e-24 Identities = 54/85 (63%), Positives = 69/85 (81%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ N+L+EC++CEEKLPTREA DVVI Y+ESG + KALEL+SFVLK +NA+P + ACNS Sbjct: 115 EVDNVLSECLQCEEKLPTREALDVVIHNYAESGLLSKALELFSFVLKNYNALPRLTACNS 174 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLNGLV +G +E A +Y EM +RD Sbjct: 175 LLNGLVMDGNMEAAWRLYDEMAKRD 199 >gb|EYU24651.1| hypothetical protein MIMGU_mgv1a022213mg, partial [Erythranthe guttata] Length = 737 Score = 115 bits (289), Expect = 9e-24 Identities = 54/85 (63%), Positives = 69/85 (81%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ N+L+EC++CEEKLPTREA DVVI Y+ESG + KALEL+SFVLK +NA+P + ACNS Sbjct: 115 EVDNVLSECLQCEEKLPTREALDVVIHNYAESGLLSKALELFSFVLKNYNALPRLTACNS 174 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLNGLV +G +E A +Y EM +RD Sbjct: 175 LLNGLVMDGNMEAAWRLYDEMAKRD 199 >ref|XP_010318779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] gi|723686588|ref|XP_010318780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] gi|723686591|ref|XP_010318781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] gi|723686594|ref|XP_010318782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] Length = 814 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/84 (55%), Positives = 64/84 (76%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI +LL+ CE+K PT EA D VI+AYS+S V+KA+ELY FVL+ +N VPHV+ NS Sbjct: 117 EIDSLLSSLTTCEDKFPTLEALDAVIKAYSDSNLVDKAVELYYFVLRTYNLVPHVVTVNS 176 Query: 77 LLNGLVNNGKLEIAQNVYKEMVER 6 LL+GLV +GK++ A+ +Y E+VER Sbjct: 177 LLHGLVKHGKIKTARRLYDELVER 200 >ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X1 [Solanum tuberosum] gi|565397234|ref|XP_006364205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X2 [Solanum tuberosum] Length = 816 Score = 96.7 bits (239), Expect = 5e-18 Identities = 46/84 (54%), Positives = 64/84 (76%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI +LL+ CE+K PT EA D VI+AYS+S V+KA+ELY FVL+ ++ VPHV+ NS Sbjct: 116 EIESLLSSLTTCEDKFPTLEALDAVIKAYSDSNLVDKAVELYYFVLRTYDLVPHVVTVNS 175 Query: 77 LLNGLVNNGKLEIAQNVYKEMVER 6 LL+GLV +GK++ A+ +Y E+VER Sbjct: 176 LLHGLVKHGKIKAARRLYDELVER 199 >gb|EPS73576.1| hypothetical protein M569_01176, partial [Genlisea aurea] Length = 757 Score = 96.3 bits (238), Expect = 7e-18 Identities = 48/85 (56%), Positives = 62/85 (72%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ N+LAEC+ EK PT E+ D VI AY E+G + KAL++YSF LK +++VP +LACNS Sbjct: 111 ELDNVLAECIHSAEKRPTLESLDDVINAYVEAGLLGKALDVYSFGLKAYDSVPGLLACNS 170 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLNGLV G + A VY EMV+RD Sbjct: 171 LLNGLVKGGDIRAAWGVYNEMVKRD 195 >ref|XP_009630608.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana tomentosiformis] gi|697152747|ref|XP_009630609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana tomentosiformis] Length = 817 Score = 95.9 bits (237), Expect = 9e-18 Identities = 47/84 (55%), Positives = 62/84 (73%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI LL CE+KLPT EA D VI+AYS+S V+KA+ELY FVLK ++ VPHV+ NS Sbjct: 116 EIETLLPNLTTCEDKLPTLEALDAVIKAYSDSNLVDKAVELYYFVLKTYDLVPHVVTVNS 175 Query: 77 LLNGLVNNGKLEIAQNVYKEMVER 6 LL+GLV + K++ A+ +Y E+VER Sbjct: 176 LLHGLVKDSKIKAARRLYDELVER 199 >ref|XP_010654774.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Vitis vinifera] gi|731402722|ref|XP_010654775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Vitis vinifera] gi|731402724|ref|XP_010654776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Vitis vinifera] Length = 822 Score = 94.4 bits (233), Expect = 3e-17 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = -1 Query: 245 LLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNG 66 ++ E M+ EE PTREA +VI+AYS+SG VEKALELY FVLK + P V+ACNSLLN Sbjct: 115 VVLENMRVEEMSPTREAMSIVIQAYSDSGLVEKALELYYFVLKTYTYFPDVIACNSLLNM 174 Query: 65 LVNNGKLEIAQNVYKEMVERD 3 LV G++EIA+ +Y EM+E D Sbjct: 175 LVKLGRIEIARKLYDEMLEID 195 >ref|XP_009802076.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana sylvestris] gi|698514389|ref|XP_009802077.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana sylvestris] Length = 817 Score = 94.0 bits (232), Expect = 3e-17 Identities = 47/84 (55%), Positives = 62/84 (73%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI LL E+KLPT EA D VI+AYS+S V+KA+ELY FVLK ++ VPHV+ NS Sbjct: 116 EIETLLPNLTTFEDKLPTLEALDAVIKAYSDSNLVDKAVELYYFVLKTYDLVPHVVTVNS 175 Query: 77 LLNGLVNNGKLEIAQNVYKEMVER 6 LL+GLV +GK++ A+ +Y E+VER Sbjct: 176 LLHGLVKDGKIKAARQLYDELVER 199 >ref|XP_012073209.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Jatropha curcas] gi|317106735|dbj|BAJ53231.1| JHL06P13.11 [Jatropha curcas] gi|643729224|gb|KDP37104.1| hypothetical protein JCGZ_06160 [Jatropha curcas] Length = 826 Score = 93.6 bits (231), Expect = 5e-17 Identities = 51/85 (60%), Positives = 64/85 (75%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 EI NLL E MK +E +PT EA VI AY+ SG V++ALELY+ V+ HN VP V ACNS Sbjct: 114 EIENLL-ETMKSKELIPTCEALSFVISAYAGSGLVKEALELYNTVIDVHNCVPDVFACNS 172 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLN LV++GK+EIA+ VY EMV+R+ Sbjct: 173 LLNLLVHHGKVEIARKVYDEMVDRN 197 >ref|XP_010691155.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Beta vulgaris subsp. vulgaris] gi|731359197|ref|XP_010691156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Beta vulgaris subsp. vulgaris] gi|731359199|ref|XP_010691157.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Beta vulgaris subsp. vulgaris] gi|731359201|ref|XP_010691158.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Beta vulgaris subsp. vulgaris] gi|731359203|ref|XP_010691159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Beta vulgaris subsp. vulgaris] gi|870848393|gb|KMT00682.1| hypothetical protein BVRB_9g219710 [Beta vulgaris subsp. vulgaris] Length = 826 Score = 92.4 bits (228), Expect = 1e-16 Identities = 50/85 (58%), Positives = 61/85 (71%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ N+L CMK E LPT EAFDV+I+AY ++ V KA ELY FV K N +P V +CNS Sbjct: 114 EVENVLI-CMKNEGVLPTIEAFDVLIQAYVDAKLVNKARELYIFVNDKFNCMPSVYSCNS 172 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLNGLV NG ++IA VY EM+ERD Sbjct: 173 LLNGLVKNGDVKIALEVYDEMLERD 197 >emb|CDO98138.1| unnamed protein product [Coffea canephora] Length = 820 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/75 (58%), Positives = 57/75 (76%) Frame = -1 Query: 230 MKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNGLVNNG 51 MKC+ K+P+REAFDV+IRAYS+ G V+KA+ELYSF + V +VLACNSLLNGLV G Sbjct: 121 MKCQGKVPSREAFDVIIRAYSDCGLVDKAVELYSFEVNTCGLVANVLACNSLLNGLVKKG 180 Query: 50 KLEIAQNVYKEMVER 6 + A +Y ++VER Sbjct: 181 NINDAMRIYCDIVER 195 >ref|XP_006368374.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550346285|gb|ERP64943.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 826 Score = 91.7 bits (226), Expect = 2e-16 Identities = 46/85 (54%), Positives = 60/85 (70%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ NLL E MKC++ PTREA V+ AY +SG V +ALELY HN +P V+ACN+ Sbjct: 117 EVENLL-ETMKCKDLAPTREALSFVVGAYVDSGLVNRALELYHIAYDIHNYLPDVIACNA 175 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLN L+ K+EIA+ VY+EMV+RD Sbjct: 176 LLNALIQQKKVEIARKVYEEMVKRD 200 >ref|XP_011016641.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Populus euphratica] gi|743944249|ref|XP_011016642.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Populus euphratica] gi|743944251|ref|XP_011016643.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Populus euphratica] Length = 826 Score = 89.7 bits (221), Expect = 7e-16 Identities = 46/85 (54%), Positives = 59/85 (69%) Frame = -1 Query: 257 EIGNLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNS 78 E+ NLL E MKC++ PTREA VI AY +SG V +ALELY HN +P V+ACN+ Sbjct: 117 EVENLL-ETMKCKDLAPTREALSFVIGAYVDSGLVNRALELYHIAYDIHNFLPDVIACNA 175 Query: 77 LLNGLVNNGKLEIAQNVYKEMVERD 3 LLN L+ K+EIA+ VY+EMV+ D Sbjct: 176 LLNALIQQKKVEIAREVYEEMVKMD 200 >ref|XP_009348770.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Pyrus x bretschneideri] gi|694444512|ref|XP_009348772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Pyrus x bretschneideri] Length = 818 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/81 (51%), Positives = 57/81 (70%) Frame = -1 Query: 248 NLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLN 69 +L+ + +K EE PT +A VIRAY++SG V KAL+LY V+K + VP V ACNSLLN Sbjct: 115 DLVMDKVKLEEVKPTHDALSFVIRAYADSGMVGKALDLYDIVVKVYGVVPSVFACNSLLN 174 Query: 68 GLVNNGKLEIAQNVYKEMVER 6 LV N ++++A+ VY EM ER Sbjct: 175 VLVKNRRVDVARRVYDEMAER 195 >ref|XP_009339263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Pyrus x bretschneideri] Length = 819 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/81 (51%), Positives = 57/81 (70%) Frame = -1 Query: 248 NLLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLN 69 +L+ + +K EE PT +A VIRAY++SG V KAL+LY V+K + VP V ACNSLLN Sbjct: 116 DLVMDKVKLEEVKPTHDALSFVIRAYADSGMVGKALDLYDIVVKVYGVVPSVFACNSLLN 175 Query: 68 GLVNNGKLEIAQNVYKEMVER 6 LV N ++++A+ VY EM ER Sbjct: 176 VLVKNRRVDVARRVYDEMAER 196 >ref|XP_008243864.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Prunus mume] Length = 824 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/80 (52%), Positives = 58/80 (72%) Frame = -1 Query: 245 LLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNG 66 L+ E MK EE PT +A VIRAY++SG V+KAL+ Y FV+K ++ VP V ACN+LLN Sbjct: 116 LVMEQMKFEEVKPTIDALSFVIRAYADSGLVDKALDFYCFVVKVYDCVPDVFACNTLLNV 175 Query: 65 LVNNGKLEIAQNVYKEMVER 6 LV N ++++A+ VY EM E+ Sbjct: 176 LVKNRRVDVARRVYDEMAEK 195 >ref|XP_002517612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543244|gb|EEF44776.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 794 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/80 (51%), Positives = 58/80 (72%) Frame = -1 Query: 242 LAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNGL 63 L + MK ++ +PTREAF +VI +++ G V++ALE Y +K H+ VP V +CNSLLN L Sbjct: 88 LLKIMKSKDLMPTREAFSLVISVFADCGLVDRALEFYRTFIKIHHCVPDVFSCNSLLNVL 147 Query: 62 VNNGKLEIAQNVYKEMVERD 3 V +GK+EIA VY EMV+R+ Sbjct: 148 VKHGKVEIACKVYDEMVDRN 167 >ref|XP_007150739.1| hypothetical protein PHAVU_005G176600g [Phaseolus vulgaris] gi|561024003|gb|ESW22733.1| hypothetical protein PHAVU_005G176600g [Phaseolus vulgaris] Length = 820 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/81 (48%), Positives = 58/81 (71%) Frame = -1 Query: 245 LLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNG 66 L+ E MK + +PTR AF +I AY+E G V++AL+L+ V + H+ P V+ACNSLLNG Sbjct: 112 LVLESMKVQHLIPTRAAFSALILAYAECGSVDRALQLFHAVREMHSCFPSVVACNSLLNG 171 Query: 65 LVNNGKLEIAQNVYKEMVERD 3 LV +GK+++A +Y EM++ D Sbjct: 172 LVKSGKVDVALQLYDEMLQTD 192 >emb|CBI36298.3| unnamed protein product [Vitis vinifera] Length = 641 Score = 84.7 bits (208), Expect = 2e-14 Identities = 45/79 (56%), Positives = 57/79 (72%) Frame = -1 Query: 245 LLAECMKCEEKLPTREAFDVVIRAYSESGQVEKALELYSFVLKKHNAVPHVLACNSLLNG 66 ++ E M+ EE PTREA +VI+AYS+SG VEKALELY FVLK + P V+ACNSLLN Sbjct: 115 VVLENMRVEEMSPTREAMSIVIQAYSDSGLVEKALELYYFVLKTYTYFPDVIACNSLLNM 174 Query: 65 LVNNGKLEIAQNVYKEMVE 9 LV G++EIA+ MV+ Sbjct: 175 LVKLGRIEIARKFTCIMVK 193