BLASTX nr result
ID: Forsythia21_contig00056982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056982 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002538339.1| conserved hypothetical protein [Ricinus comm... 120 5e-25 ref|YP_009049771.1| hypothetical protein (mitochondrion) [Capsic... 71 3e-10 ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrio... 41 3e-06 ref|XP_002538338.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002538339.1| conserved hypothetical protein [Ricinus communis] gi|223512664|gb|EEF24045.1| conserved hypothetical protein [Ricinus communis] Length = 153 Score = 120 bits (300), Expect = 5e-25 Identities = 57/63 (90%), Positives = 60/63 (95%) Frame = -2 Query: 190 MNETNQKCKSRKRSRETDRSATTRTRVGGVLSVSYHSCSGKDPQLSKGPPTARITAANPP 11 M+ETNQKCKSRKRSR+TDRSATTRTRVG VLS+SYHSCSGKDPQLSKGPPTARIT ANPP Sbjct: 1 MDETNQKCKSRKRSRKTDRSATTRTRVGEVLSMSYHSCSGKDPQLSKGPPTARITVANPP 60 Query: 10 FTQ 2 TQ Sbjct: 61 LTQ 63 >ref|YP_009049771.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751866|gb|AIG89953.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752043|gb|AIG90129.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 146 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +2 Query: 206 MDYEGVSQAVRVFGRFPFAY-PPHSPLVGRVVNLEGS 313 MDYEGVSQAVRVFGRFPFA+ PPHSPLVGRVVNLEG+ Sbjct: 1 MDYEGVSQAVRVFGRFPFAFPPPHSPLVGRVVNLEGA 37 >ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] gi|403311591|gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +3 Query: 201 NEWTMKGSVKRFGFSVGSRSPTP 269 N MKGSVKRFGFSVGSRSP P Sbjct: 2 NRVCMKGSVKRFGFSVGSRSPAP 24 Score = 36.2 bits (82), Expect(2) = 3e-06 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 266 PPHSPLVGRVVNLEGS 313 PPHSPLVGRVVNLEG+ Sbjct: 24 PPHSPLVGRVVNLEGA 39 >ref|XP_002538338.1| conserved hypothetical protein [Ricinus communis] gi|223512663|gb|EEF24044.1| conserved hypothetical protein, partial [Ricinus communis] Length = 92 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 224 SQAVRVFGRFPFAYPPHSPLVGRVVNLEGS 313 SQ+VRV GRFPFA PPHSPLVGRVVNLEG+ Sbjct: 6 SQSVRVLGRFPFACPPHSPLVGRVVNLEGA 35