BLASTX nr result
ID: Forsythia21_contig00056941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056941 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081292.1| PREDICTED: formin BNI1-like [Sesamum indicum] 93 6e-17 ref|XP_009798767.1| PREDICTED: hepatoma-derived growth factor-re... 59 1e-06 emb|CDP10006.1| unnamed protein product [Coffea canephora] 58 2e-06 >ref|XP_011081292.1| PREDICTED: formin BNI1-like [Sesamum indicum] Length = 536 Score = 93.2 bits (230), Expect = 6e-17 Identities = 51/89 (57%), Positives = 61/89 (68%) Frame = -1 Query: 268 PPPPPPTHLRKSVLMKSNSSVLNDAVCYEKQLRRSVMSVPTQELSETELDGPPRRANFGS 89 PPPPPP LRK+VL KSNSSV N+A EK LRRSV SVPT+ELSE+E++ P RR N G Sbjct: 335 PPPPPPPFLRKAVLTKSNSSVTNNAAAPEKLLRRSVRSVPTEELSESEMEEPWRRMNHGV 394 Query: 88 DFKAARVGSDDVPFVGKSVRTIRRDEFQV 2 +FK G + GKSVRT R +E + Sbjct: 395 EFK----GRMQIDSGGKSVRTFRPNELVI 419 >ref|XP_009798767.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like [Nicotiana sylvestris] Length = 543 Score = 59.3 bits (142), Expect = 1e-06 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 2/89 (2%) Frame = -1 Query: 268 PPPPPPTHL--RKSVLMKSNSSVLNDAVCYEKQLRRSVMSVPTQELSETELDGPPRRANF 95 PPPPPP H + S LMKS+SS +++V EK+LRRS+ SVP E S E PP++A Sbjct: 341 PPPPPPPHFFYKNSPLMKSSSSARDESVSTEKELRRSIRSVP-MESSSNEKFQPPKKAYS 399 Query: 94 GSDFKAARVGSDDVPFVGKSVRTIRRDEF 8 G + + PF+G + +EF Sbjct: 400 GKELR---------PFIGSARAKEYGEEF 419 >emb|CDP10006.1| unnamed protein product [Coffea canephora] Length = 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%) Frame = -1 Query: 268 PPPPPPTHLRKSVLMKSNSSVLNDAVCYEKQLRRSVMSVPTQELSETELDGPPRRANFGS 89 PPPPPP + ++ L KS+SS++N E++L+RS SVP +L+ETE++G RRAN G Sbjct: 335 PPPPPPPFILRAPLEKSSSSLVNGNHFSEEELKRSTRSVP-NDLTETEMEGLSRRANSGP 393 Query: 88 DFK 80 + + Sbjct: 394 ELR 396