BLASTX nr result
ID: Forsythia21_contig00056940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056940 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081292.1| PREDICTED: formin BNI1-like [Sesamum indicum] 59 1e-06 >ref|XP_011081292.1| PREDICTED: formin BNI1-like [Sesamum indicum] Length = 536 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/63 (53%), Positives = 42/63 (66%) Frame = -1 Query: 194 SNVLNDAVCSEKQLRRSVMSVPTQELSETELDEPPRRANFRSDFKAARVGSDDVPFVGKS 15 S+V N+A EK LRRSV SVPT+ELSE+E++EP RR N +FK G + GKS Sbjct: 353 SSVTNNAAAPEKLLRRSVRSVPTEELSESEMEEPWRRMNHGVEFK----GRMQIDSGGKS 408 Query: 14 VRT 6 VRT Sbjct: 409 VRT 411