BLASTX nr result
ID: Forsythia21_contig00056858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056858 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083369.1| PREDICTED: protein LYK5 [Sesamum indicum] 59 2e-06 >ref|XP_011083369.1| PREDICTED: protein LYK5 [Sesamum indicum] Length = 645 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -1 Query: 234 CNSELQCQPRYVNNKQLNCQQNDTTTIGFICNGTTTSCHS 115 C S Q QP YVNNKQL+C QNDTTT+GF+CNG TSC S Sbjct: 13 CQSHAQ-QP-YVNNKQLDCNQNDTTTLGFVCNGAFTSCPS 50