BLASTX nr result
ID: Forsythia21_contig00056592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056592 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG19978.1| hypothetical protein MPH_02708 [Macrophomina phas... 60 7e-07 ref|XP_007587596.1| putative nad -binding-like protein [Neofusic... 56 8e-06 >gb|EKG19978.1| hypothetical protein MPH_02708 [Macrophomina phaseolina MS6] Length = 284 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -3 Query: 278 EPWNTSTN---VKKSVSDLKAINLAFPHLQSSATVLAMAAWFAVLCITDDLVEAMSAKDA 108 EPW +K SV ++ + AFP + + VLAMAAWF+VL + DDLVE M A Sbjct: 4 EPWKDGGEEAMIKASVKEIGIVRNAFPLVPRAEAVLAMAAWFSVLLLVDDLVEDMGTAQA 63 Query: 107 EQSLLTTLAILR 72 ++L T++ ILR Sbjct: 64 HEALSTSIRILR 75 >ref|XP_007587596.1| putative nad -binding-like protein [Neofusicoccum parvum UCRNP2] gi|485918196|gb|EOD44909.1| putative nad -binding-like protein [Neofusicoccum parvum UCRNP2] Length = 386 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = -3 Query: 239 SDLKAINLAFPHLQSSATVLAMAAWFAVLCITDDLVEAMSAKDAEQSLLTTLAILRFG 66 +DL +N AFP L+S+A VL MAAWF +LC DDL+E + A E+ + + +LR G Sbjct: 84 TDLATVNTAFPSLRSAAIVLCMAAWFRLLCRVDDLLERLPACAVERVVSANIDVLRRG 141