BLASTX nr result
ID: Forsythia21_contig00055897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055897 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232139.1| PREDICTED: PI-PLC X domain-containing protei... 66 1e-08 ref|XP_006338342.1| PREDICTED: PI-PLC X domain-containing protei... 65 2e-08 ref|XP_011099035.1| PREDICTED: PI-PLC X domain-containing protei... 64 5e-08 emb|CDP19975.1| unnamed protein product [Coffea canephora] 64 5e-08 ref|XP_009596990.1| PREDICTED: PI-PLC X domain-containing protei... 63 7e-08 ref|XP_009792587.1| PREDICTED: PI-PLC X domain-containing protei... 63 9e-08 ref|XP_009373787.1| PREDICTED: PI-PLC X domain-containing protei... 60 4e-07 ref|XP_010032556.1| PREDICTED: PI-PLC X domain-containing protei... 60 7e-07 gb|KCW51952.1| hypothetical protein EUGRSUZ_J01396, partial [Euc... 60 7e-07 ref|XP_002277997.1| PREDICTED: PI-PLC X domain-containing protei... 60 7e-07 ref|XP_007151350.1| hypothetical protein PHAVU_004G039000g [Phas... 60 7e-07 ref|XP_010936444.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 ref|XP_010936443.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 ref|XP_010936441.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 gb|KHN04383.1| PI-PLC X domain-containing protein [Glycine soja] 59 2e-06 ref|XP_008341802.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 ref|XP_008341801.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 ref|XP_008379446.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 ref|XP_003554924.1| PREDICTED: PI-PLC X domain-containing protei... 59 2e-06 gb|KEH21727.1| PLC-like phosphodiesterase superfamily protein [M... 58 2e-06 >ref|XP_004232139.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Solanum lycopersicum] Length = 374 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSG+L+DML TCHD AANRWANF+AVDFYK S Sbjct: 296 VQNSGNLLDMLMTCHDTAANRWANFIAVDFYKRS 329 >ref|XP_006338342.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Solanum tuberosum] Length = 367 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSG L+DML TCHD AANRWANF+AVDFYK S Sbjct: 296 VQNSGHLLDMLMTCHDAAANRWANFIAVDFYKRS 329 >ref|XP_011099035.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Sesamum indicum] Length = 361 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSGDL+DMLQTC+ A NRWANFVAVDFYK S Sbjct: 293 VQNSGDLLDMLQTCYGAAGNRWANFVAVDFYKRS 326 >emb|CDP19975.1| unnamed protein product [Coffea canephora] Length = 349 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSG+LIDMLQTCH +ANRWANFVAVD+YK S Sbjct: 287 VQNSGNLIDMLQTCHAASANRWANFVAVDYYKRS 320 >ref|XP_009596990.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nicotiana tomentosiformis] Length = 368 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSG+L+DML TCH+ AANRWANF+AVD+YK S Sbjct: 295 VQNSGELLDMLMTCHNAAANRWANFIAVDYYKRS 328 >ref|XP_009792587.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nicotiana sylvestris] Length = 368 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNSG+L+DML TCH+ AANRWANF+AVD+YK S Sbjct: 295 VQNSGELLDMLTTCHNAAANRWANFIAVDYYKRS 328 >ref|XP_009373787.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Pyrus x bretschneideri] Length = 372 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSGDLI+ML TCH AANRWANFVAVDFYK S Sbjct: 304 NSGDLINMLYTCHGAAANRWANFVAVDFYKRS 335 >ref|XP_010032556.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Eucalyptus grandis] Length = 364 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 250 QNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 +NSGDLIDML TC+ A NRWANFVAVDFYK S Sbjct: 295 ENSGDLIDMLHTCYGAAGNRWANFVAVDFYKRS 327 >gb|KCW51952.1| hypothetical protein EUGRSUZ_J01396, partial [Eucalyptus grandis] Length = 354 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 250 QNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 +NSGDLIDML TC+ A NRWANFVAVDFYK S Sbjct: 295 ENSGDLIDMLHTCYGAAGNRWANFVAVDFYKRS 327 >ref|XP_002277997.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Vitis vinifera] gi|298204463|emb|CBI16943.3| unnamed protein product [Vitis vinifera] Length = 364 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 250 QNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 QNSGDLI+MLQTC+ A NRWANFVAVD+YK S Sbjct: 294 QNSGDLINMLQTCYGAAGNRWANFVAVDYYKRS 326 >ref|XP_007151350.1| hypothetical protein PHAVU_004G039000g [Phaseolus vulgaris] gi|561024659|gb|ESW23344.1| hypothetical protein PHAVU_004G039000g [Phaseolus vulgaris] Length = 353 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYK 158 NSG LIDMLQTCHD A NRWAN+VAVD+YK Sbjct: 296 NSGGLIDMLQTCHDAAGNRWANYVAVDYYK 325 >ref|XP_010936444.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform X3 [Elaeis guineensis] Length = 373 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNS DLI ML TC++ AANRWANFVAVD+YK S Sbjct: 301 VQNSADLIGMLNTCYNAAANRWANFVAVDYYKRS 334 >ref|XP_010936443.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform X2 [Elaeis guineensis] Length = 397 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNS DLI ML TC++ AANRWANFVAVD+YK S Sbjct: 326 VQNSADLIGMLNTCYNAAANRWANFVAVDYYKRS 359 >ref|XP_010936441.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform X1 [Elaeis guineensis] Length = 398 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 VQNS DLI ML TC++ AANRWANFVAVD+YK S Sbjct: 326 VQNSADLIGMLNTCYNAAANRWANFVAVDYYKRS 359 >gb|KHN04383.1| PI-PLC X domain-containing protein [Glycine soja] Length = 368 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSG LIDMLQTCH AANRWAN++AVD+YK S Sbjct: 296 NSGGLIDMLQTCHGAAANRWANYLAVDYYKRS 327 >ref|XP_008341802.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like isoform X2 [Malus domestica] gi|658052964|ref|XP_008362220.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like isoform X2 [Malus domestica] Length = 319 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSG+LI+ML TCH AANRWANFVAVDFYK S Sbjct: 251 NSGNLINMLYTCHGAAANRWANFVAVDFYKRS 282 >ref|XP_008341801.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like isoform X1 [Malus domestica] gi|658052962|ref|XP_008362219.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like isoform X1 [Malus domestica] Length = 365 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSG+LI+ML TCH AANRWANFVAVDFYK S Sbjct: 297 NSGNLINMLYTCHGAAANRWANFVAVDFYKRS 328 >ref|XP_008379446.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Malus domestica] Length = 378 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 253 VQNSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 V NSG+LI+ML TCH A NRWANFVAVDFYK S Sbjct: 308 VDNSGNLINMLYTCHGAAGNRWANFVAVDFYKRS 341 >ref|XP_003554924.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Glycine max] Length = 364 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSG LIDMLQTCH AANRWAN++AVD+YK S Sbjct: 296 NSGGLIDMLQTCHGAAANRWANYLAVDYYKRS 327 >gb|KEH21727.1| PLC-like phosphodiesterase superfamily protein [Medicago truncatula] Length = 364 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 247 NSGDLIDMLQTCHDVAANRWANFVAVDFYKAS 152 NSG LIDMLQTC+ A NRWANFVAVDFYK S Sbjct: 295 NSGGLIDMLQTCYGAAGNRWANFVAVDFYKRS 326