BLASTX nr result
ID: Forsythia21_contig00055095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055095 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007694284.1| hypothetical protein COCSADRAFT_32403 [Bipol... 57 5e-06 gb|EMD95535.1| hypothetical protein COCHEDRAFT_1089584 [Bipolari... 56 8e-06 >ref|XP_007694284.1| hypothetical protein COCSADRAFT_32403 [Bipolaris sorokiniana ND90Pr] gi|451856432|gb|EMD69723.1| hypothetical protein COCSADRAFT_32403 [Bipolaris sorokiniana ND90Pr] Length = 248 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +3 Query: 15 SSEAPYPTTVMTSAMVPAYSTGVSANGTVPMPTAGGNATTSRLPEATTNAASGV 176 +S APYPTT M SA + G+ NGTVP PT GGN+TT LPE TTNAA+G+ Sbjct: 179 ASVAPYPTT-MASAPAAVGTGGLYPNGTVPKPT-GGNSTTPPLPEQTTNAAAGL 230 >gb|EMD95535.1| hypothetical protein COCHEDRAFT_1089584 [Bipolaris maydis C5] gi|477593330|gb|ENI10399.1| hypothetical protein COCC4DRAFT_55063 [Bipolaris maydis ATCC 48331] Length = 240 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +3 Query: 15 SSEAPYPTTVMTSAMVPAYSTGVSANGTVPMPTAGGNATTSRLPEATTNAASGV 176 +S APYPTT M SA P + G+ NGTVP PT G N+T+ LPE TTNAA+G+ Sbjct: 171 ASVAPYPTT-MASAPAPIATGGLYPNGTVPKPT-GANSTSPPLPEQTTNAAAGL 222