BLASTX nr result
ID: Forsythia21_contig00052538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00052538 (328 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012082151.1| PREDICTED: protein IDA [Jatropha curcas] gi|... 57 4e-06 >ref|XP_012082151.1| PREDICTED: protein IDA [Jatropha curcas] gi|643717989|gb|KDP29345.1| hypothetical protein JCGZ_18266 [Jatropha curcas] Length = 88 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/74 (44%), Positives = 42/74 (56%), Gaps = 6/74 (8%) Frame = -1 Query: 325 KLIYILFFGFFLVNSCMAIRPGRTLMKEDVSVMILKHYKQKHSLPEGLF------STRLP 164 K+IY+LF+ L++SCMA RPG TLM + M ++ K L E F LP Sbjct: 10 KIIYLLFYFLLLLSSCMAARPGVTLMVDKRVFMPSENKKSNRKLYETSFFYGNRMFNYLP 69 Query: 163 KGSVVAPSGPSKRH 122 KG + PSGPSKRH Sbjct: 70 KGVPIPPSGPSKRH 83