BLASTX nr result
ID: Forsythia21_contig00050328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00050328 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008237676.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, part... 144 2e-32 ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 143 5e-32 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 143 5e-32 ref|XP_002519129.1| pentatricopeptide repeat-containing protein,... 142 1e-31 ref|XP_009613228.1| PREDICTED: pentatricopeptide repeat-containi... 140 3e-31 ref|XP_009769334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 140 3e-31 ref|XP_009769332.1| PREDICTED: pentatricopeptide repeat-containi... 140 3e-31 ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citr... 140 4e-31 ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 139 7e-31 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 139 7e-31 ref|XP_002269015.2| PREDICTED: pentatricopeptide repeat-containi... 137 4e-30 emb|CBI20053.3| unnamed protein product [Vitis vinifera] 137 4e-30 ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containi... 135 1e-29 ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phas... 134 2e-29 ref|XP_008454893.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_008454892.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_006384483.1| hypothetical protein POPTR_0004s15480g [Popu... 134 2e-29 ref|XP_011005660.1| PREDICTED: pentatricopeptide repeat-containi... 133 4e-29 >ref|XP_008237676.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Prunus mume] Length = 630 Score = 144 bits (364), Expect = 2e-32 Identities = 66/89 (74%), Positives = 79/89 (88%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 +S+I DLLLRA CE+K+ D+A +CFY+M +KG +PK ETCN+MLSLFL+LN TE+VWVL Sbjct: 151 NSSIIFDLLLRACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVL 210 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMFRLKI SSVCTFNIMIN+LCKEGKL Sbjct: 211 YAEMFRLKINSSVCTFNIMINVLCKEGKL 239 >ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] gi|462396924|gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] Length = 545 Score = 144 bits (364), Expect = 2e-32 Identities = 66/89 (74%), Positives = 79/89 (88%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 +S+I DLLLRA CE+K+ D+A +CFY+M +KG +PK ETCN+MLSLFL+LN TE+VWVL Sbjct: 95 NSSIIFDLLLRACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVL 154 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMFRLKI SSVCTFNIMIN+LCKEGKL Sbjct: 155 YAEMFRLKINSSVCTFNIMINVLCKEGKL 183 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 143 bits (360), Expect = 5e-32 Identities = 61/88 (69%), Positives = 80/88 (90%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I LDLL+RA+CELK+G+DA CFY+MK+KG+LPK+ETCN++LSLFL+LN T W++Y Sbjct: 139 SSIVLDLLVRAYCELKKGEDALKCFYLMKQKGILPKVETCNDLLSLFLKLNRTHLAWIVY 198 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+K+ S+VCTFNIMIN+LC+EGKL Sbjct: 199 AEMFRMKMSSTVCTFNIMINVLCREGKL 226 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Solanum lycopersicum] Length = 618 Score = 143 bits (360), Expect = 5e-32 Identities = 61/88 (69%), Positives = 80/88 (90%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I LDLL+RA+CELK+G+DA CFY+MK+KG+LPK+ETCN++LSLFL+LN T W++Y Sbjct: 139 SSIVLDLLVRAYCELKKGEDALKCFYLMKQKGILPKVETCNDLLSLFLKLNRTHLAWIVY 198 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+K+ S+VCTFNIMIN+LC+EGKL Sbjct: 199 AEMFRMKMSSTVCTFNIMINVLCREGKL 226 >ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541792|gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 643 Score = 142 bits (357), Expect = 1e-31 Identities = 70/88 (79%), Positives = 77/88 (87%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I D+L+RA CELKRGDDA CF MMKEKGV+PKIET N MLSLFL+LN TE VWVLY Sbjct: 165 SSIVFDMLIRACCELKRGDDAFECFDMMKEKGVVPKIETFNAMLSLFLKLNQTETVWVLY 224 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRLKIKS+V TFNIMIN+LCKEGKL Sbjct: 225 AEMFRLKIKSTVYTFNIMINVLCKEGKL 252 >ref|XP_009613228.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Nicotiana tomentosiformis] Length = 629 Score = 140 bits (354), Expect = 3e-31 Identities = 62/88 (70%), Positives = 79/88 (89%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I LDLL+RA+CELK+G++A CFY+MK+KG+LPKIETCN++LSLF +LN T W++Y Sbjct: 150 SSIVLDLLVRAYCELKKGEEALKCFYLMKQKGILPKIETCNDLLSLFNKLNRTHLSWIVY 209 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+KI S+VCTFNIMIN+LCKEGKL Sbjct: 210 AEMFRMKISSTVCTFNIMINVLCKEGKL 237 >ref|XP_009769334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Nicotiana sylvestris] Length = 629 Score = 140 bits (353), Expect = 3e-31 Identities = 61/88 (69%), Positives = 79/88 (89%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I LDLL+RA+CELK+G++A CFY++K+KG+LPKIETCN++LSLF +LN T W++Y Sbjct: 150 SSIVLDLLVRAYCELKKGEEALKCFYLLKQKGILPKIETCNDLLSLFNKLNRTHLAWIVY 209 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+KI S+VCTFNIMIN+LCKEGKL Sbjct: 210 AEMFRMKISSTVCTFNIMINVLCKEGKL 237 >ref|XP_009769332.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Nicotiana sylvestris] Length = 629 Score = 140 bits (353), Expect = 3e-31 Identities = 61/88 (69%), Positives = 79/88 (89%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I LDLL+RA+CELK+G++A CFY++K+KG+LPKIETCN++LSLF +LN T W++Y Sbjct: 150 SSIVLDLLVRAYCELKKGEEALKCFYLLKQKGILPKIETCNDLLSLFNKLNRTHLAWIVY 209 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+KI S+VCTFNIMIN+LCKEGKL Sbjct: 210 AEMFRMKISSTVCTFNIMINVLCKEGKL 237 >ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] gi|568851376|ref|XP_006479369.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Citrus sinensis] gi|557525069|gb|ESR36375.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] Length = 645 Score = 140 bits (352), Expect = 4e-31 Identities = 67/89 (75%), Positives = 76/89 (85%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 SST+ D LLR CELKR DDA CFYMMKEKG +PKIE+CN+MLS+F++LN K WVL Sbjct: 167 SSTV-FDFLLRVCCELKRDDDAFKCFYMMKEKGFVPKIESCNDMLSMFVKLNRPYKAWVL 225 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMFR++IKSSVCTFNIMINLLCKEGKL Sbjct: 226 YAEMFRMRIKSSVCTFNIMINLLCKEGKL 254 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 139 bits (350), Expect = 7e-31 Identities = 63/89 (70%), Positives = 77/89 (86%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 S+TI DLL+RA CE+KR D+ CFYMMK+KG++PKIETCN+MLS FL+LN TE WVL Sbjct: 170 STTILFDLLIRACCEMKRVDEGLECFYMMKDKGLIPKIETCNDMLSTFLKLNRTESAWVL 229 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMF+++IKSS+ TFNIMIN+LCKEGKL Sbjct: 230 YAEMFKMRIKSSIYTFNIMINVLCKEGKL 258 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 139 bits (350), Expect = 7e-31 Identities = 63/89 (70%), Positives = 77/89 (86%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 S+TI DLL+RA CE+KR D+ CFYMMK+KG++PKIETCN+MLS FL+LN TE WVL Sbjct: 170 STTILFDLLIRACCEMKRVDEGLECFYMMKDKGLIPKIETCNDMLSTFLKLNRTESAWVL 229 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMF+++IKSS+ TFNIMIN+LCKEGKL Sbjct: 230 YAEMFKMRIKSSIYTFNIMINVLCKEGKL 258 >ref|XP_002269015.2| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Vitis vinifera] Length = 660 Score = 137 bits (344), Expect = 4e-30 Identities = 63/88 (71%), Positives = 75/88 (85%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I DLL+R CEL+R D+A CFYMMKEKG++PKIETCN+MLSLFL+LN E WVLY Sbjct: 182 SSIVFDLLVRVCCELRRADEAFKCFYMMKEKGIVPKIETCNDMLSLFLKLNRMEMAWVLY 241 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRL+I S+V TFNIM+N+LCKEGKL Sbjct: 242 AEMFRLRISSTVYTFNIMVNVLCKEGKL 269 >emb|CBI20053.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 137 bits (344), Expect = 4e-30 Identities = 63/88 (71%), Positives = 75/88 (85%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I DLL+R CEL+R D+A CFYMMKEKG++PKIETCN+MLSLFL+LN E WVLY Sbjct: 156 SSIVFDLLVRVCCELRRADEAFKCFYMMKEKGIVPKIETCNDMLSLFLKLNRMEMAWVLY 215 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRL+I S+V TFNIM+N+LCKEGKL Sbjct: 216 AEMFRLRISSTVYTFNIMVNVLCKEGKL 243 >ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Jatropha curcas] gi|643740596|gb|KDP46186.1| hypothetical protein JCGZ_10026 [Jatropha curcas] Length = 649 Score = 135 bits (340), Expect = 1e-29 Identities = 64/88 (72%), Positives = 77/88 (87%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I DLL+RA CE+KRGD+A CF MMK+KG +PKIETCN+MLSLFL+LN T+ WVLY Sbjct: 171 SSILFDLLIRACCEMKRGDNAFMCFDMMKKKGTVPKIETCNDMLSLFLKLNRTDVAWVLY 230 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRL+I+S+V TFNIMIN+LCKEGKL Sbjct: 231 AEMFRLRIQSTVYTFNIMINVLCKEGKL 258 >ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Gossypium raimondii] gi|763780763|gb|KJB47834.1| hypothetical protein B456_008G044300 [Gossypium raimondii] Length = 631 Score = 134 bits (338), Expect = 2e-29 Identities = 61/89 (68%), Positives = 75/89 (84%) Frame = -2 Query: 268 SSTICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVL 89 S+T+ DLL++A CE+KR D+ CFYMMK+KG +PKIETCN +LS FL+LN TE WVL Sbjct: 151 STTLLFDLLIKACCEMKRVDEGLECFYMMKDKGFIPKIETCNALLSTFLKLNRTESAWVL 210 Query: 88 YAEMFRLKIKSSVCTFNIMINLLCKEGKL 2 YAEMF+++IKSSV TFNIMIN+LCKEGKL Sbjct: 211 YAEMFKMRIKSSVYTFNIMINVLCKEGKL 239 >ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris] gi|561035098|gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris] Length = 618 Score = 134 bits (338), Expect = 2e-29 Identities = 61/88 (69%), Positives = 76/88 (86%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S++ DLL+RA+CELK+ ++A CFY+MKEKGV P IETCN+MLSLFL+LN T+ WVLY Sbjct: 140 SSLIFDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQMAWVLY 199 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFR+ I+SSV TFNIM+N+LCKEGKL Sbjct: 200 AEMFRMNIRSSVYTFNIMVNVLCKEGKL 227 >ref|XP_008454893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X2 [Cucumis melo] Length = 601 Score = 134 bits (337), Expect = 2e-29 Identities = 62/88 (70%), Positives = 74/88 (84%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I D L+++ C++ R D+A CFY MKEKG+LPKIETCN +LSLFL+LN TE WVLY Sbjct: 150 SSIVFDHLIKSCCDMNRADEALECFYTMKEKGILPKIETCNNLLSLFLKLNRTEAAWVLY 209 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRL+IKSSV TFNIMIN+LCKEGKL Sbjct: 210 AEMFRLRIKSSVYTFNIMINVLCKEGKL 237 >ref|XP_008454892.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Cucumis melo] Length = 628 Score = 134 bits (337), Expect = 2e-29 Identities = 62/88 (70%), Positives = 74/88 (84%) Frame = -2 Query: 265 STICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLY 86 S+I D L+++ C++ R D+A CFY MKEKG+LPKIETCN +LSLFL+LN TE WVLY Sbjct: 150 SSIVFDHLIKSCCDMNRADEALECFYTMKEKGILPKIETCNNLLSLFLKLNRTEAAWVLY 209 Query: 85 AEMFRLKIKSSVCTFNIMINLLCKEGKL 2 AEMFRL+IKSSV TFNIMIN+LCKEGKL Sbjct: 210 AEMFRLRIKSSVYTFNIMINVLCKEGKL 237 >ref|XP_006384483.1| hypothetical protein POPTR_0004s15480g [Populus trichocarpa] gi|550341101|gb|ERP62280.1| hypothetical protein POPTR_0004s15480g [Populus trichocarpa] Length = 524 Score = 134 bits (337), Expect = 2e-29 Identities = 63/86 (73%), Positives = 72/86 (83%) Frame = -2 Query: 259 ICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLYAE 80 + DLL+RA CELKRGDDA CF MMK KGV+P + CN+MLSLFL+ N TEK WVLYAE Sbjct: 48 VLYDLLIRACCELKRGDDAFECFDMMKGKGVIPHVHACNDMLSLFLKSNRTEKAWVLYAE 107 Query: 79 MFRLKIKSSVCTFNIMINLLCKEGKL 2 MFR++IKSSV TFNIMIN+LCKEGKL Sbjct: 108 MFRMRIKSSVVTFNIMINVLCKEGKL 133 >ref|XP_011005660.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Populus euphratica] gi|743923156|ref|XP_011005662.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Populus euphratica] Length = 647 Score = 133 bits (335), Expect = 4e-29 Identities = 63/86 (73%), Positives = 72/86 (83%) Frame = -2 Query: 259 ICLDLLLRAFCELKRGDDATNCFYMMKEKGVLPKIETCNEMLSLFLRLNSTEKVWVLYAE 80 + DLL+RA CELKRGDDA CF MMK KGV+P I CN+MLSLFL+ N TEK WVLYAE Sbjct: 171 VLYDLLIRACCELKRGDDAFECFDMMKGKGVIPHIHACNDMLSLFLKSNRTEKAWVLYAE 230 Query: 79 MFRLKIKSSVCTFNIMINLLCKEGKL 2 MFR++IKSSV TFNIMIN+LCK+GKL Sbjct: 231 MFRMRIKSSVVTFNIMINVLCKDGKL 256