BLASTX nr result
ID: Forsythia21_contig00050164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00050164 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007385021.1| eliciting plant response-like protein [Punct... 69 1e-09 gb|KIY50651.1| epl1 protein [Fistulina hepatica ATCC 64428] 67 6e-09 emb|CDO74206.1| hypothetical protein BN946_scf185043.g258 [Trame... 65 1e-08 emb|CDO74205.1| hypothetical protein BN946_scf185043.g257 [Trame... 65 1e-08 ref|XP_007384965.1| cerato-platanin-like protein [Punctularia st... 65 2e-08 ref|XP_001941120.1| heat-stable 19 kDa antigen precursor [Pyreno... 64 4e-08 gb|KFY90550.1| hypothetical protein V500_05110 [Pseudogymnoascus... 63 9e-08 gb|EPE08632.1| epl1 protein [Ophiostoma piceae UAMH 11346] 63 9e-08 ref|XP_007290367.1| Asp f 13-like protein [Marssonina brunnea f.... 63 9e-08 gb|AGL40519.1| cerato-platanin 4 [Crinipellis campanella] 62 1e-07 gb|KKY37726.1| putative eliciting plant response protein [Diapor... 62 2e-07 gb|KKY23993.1| putative epl1 protein [Diplodia seriata] 62 2e-07 gb|KIL93997.1| hypothetical protein FAVG1_02559 [Fusarium avenac... 62 2e-07 ref|XP_011325136.1| hypothetical protein FGSG_11205 [Fusarium gr... 62 2e-07 ref|XP_007840857.1| Protein SnodProt1 [Pestalotiopsis fici W106-... 62 2e-07 ref|XP_007853231.1| allergenic cerato-platanin asp f13 [Moniliop... 62 2e-07 gb|EGU82724.1| hypothetical protein FOXB_06779 [Fusarium oxyspor... 62 2e-07 gb|KFY44746.1| hypothetical protein V494_01337 [Pseudogymnoascus... 61 3e-07 ref|XP_007853235.1| allergenic cerato-platanin asp f13 [Moniliop... 61 3e-07 gb|EMD92796.1| hypothetical protein COCHEDRAFT_1202737 [Bipolari... 61 3e-07 >ref|XP_007385021.1| eliciting plant response-like protein [Punctularia strigosozonata HHB-11173 SS5] gi|390598520|gb|EIN07918.1| eliciting plant response-like protein [Punctularia strigosozonata HHB-11173 SS5] Length = 142 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSLPH 172 YA TGK + +L +DH GFNVAQ+A+DELTN AVA GRID AT+ C L H Sbjct: 86 YAGTGKSINVLVVDHTDTGFNVAQEALDELTNGNAVAFGRIDATATQVAVTQCGLSH 142 >gb|KIY50651.1| epl1 protein [Fistulina hepatica ATCC 64428] Length = 140 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 Y TG+ + +LAIDH GFN+A +AM++LTNNQAV LGRIDV AT+ +C L Sbjct: 86 YPDTGRSINVLAIDHADSGFNIALEAMNDLTNNQAVFLGRIDVTATQVAVSNCGL 140 >emb|CDO74206.1| hypothetical protein BN946_scf185043.g258 [Trametes cinnabarina] Length = 143 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 YA TGK + +LA+DH GFN+A +AM+ LTNNQ V LGRIDV AT+ C L Sbjct: 89 YAGTGKSINVLAVDHTDAGFNIALEAMNTLTNNQGVFLGRIDVTATQVAASQCGL 143 >emb|CDO74205.1| hypothetical protein BN946_scf185043.g257 [Trametes cinnabarina] Length = 143 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 YA TGK + +LAIDH GFN+A +AM+ LTNNQA LGRIDV AT+ C L Sbjct: 89 YADTGKSINVLAIDHADAGFNIALEAMNTLTNNQAEFLGRIDVTATQVAASQCGL 143 >ref|XP_007384965.1| cerato-platanin-like protein [Punctularia strigosozonata HHB-11173 SS5] gi|390598464|gb|EIN07862.1| cerato-platanin-like protein [Punctularia strigosozonata HHB-11173 SS5] Length = 140 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSLP 169 +A+TGK + +LAIDH GFNV Q AMD+LTN QAV LG + V AT+ C LP Sbjct: 84 FAQTGKTITVLAIDHADSGFNVGQVAMDDLTNGQAVQLGIVQVNATQVPGTACGLP 139 >ref|XP_001941120.1| heat-stable 19 kDa antigen precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977213|gb|EDU43839.1| heat-stable 19 kDa antigen precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 136 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK +++LAIDH GFN+A+ AMDELTNNQA +LGRID + ++ +C L Sbjct: 86 GKTIYVLAIDHTGAGFNLAKGAMDELTNNQAASLGRIDAQYSQVALSNCGL 136 >gb|KFY90550.1| hypothetical protein V500_05110 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] Length = 138 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 G+ + +LAIDH GFN+AQKAMD LTNNQAV LGRID +AT+ + C + Sbjct: 88 GRSINVLAIDHTDAGFNIAQKAMDALTNNQAVHLGRIDGQATQIDAKICGM 138 >gb|EPE08632.1| epl1 protein [Ophiostoma piceae UAMH 11346] Length = 136 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK +++LAIDH A G N+ AM+ELTNNQAV LGR+DV A + +C L Sbjct: 86 GKSIYVLAIDHAASGLNIGLTAMNELTNNQAVNLGRVDVTAVQTAASNCGL 136 >ref|XP_007290367.1| Asp f 13-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866201|gb|EKD19241.1| Asp f 13-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 138 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSLPH 172 GK V ILAID + GFN+AQ AMD+LT QAVALGRID +A + C L H Sbjct: 84 GKSVDILAIDRASDGFNIAQAAMDQLTGGQAVALGRIDAQAQQLPASSCGLKH 136 >gb|AGL40519.1| cerato-platanin 4 [Crinipellis campanella] Length = 144 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = +2 Query: 17 KKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 K + +LAIDH GFNVAQ AMDELT QAVALG IDV++T+ C L Sbjct: 95 KSINVLAIDHAGSGFNVAQAAMDELTGGQAVALGNIDVQSTRVASSACGL 144 >gb|KKY37726.1| putative eliciting plant response protein [Diaporthe ampelina] Length = 138 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSLP 169 G+ + +LAIDH A GFN+AQ A++ELTN QA ALG ++ A + DC LP Sbjct: 87 GRTINVLAIDHAATGFNIAQAALNELTNGQAAALGHVEATAVQVPASDCGLP 138 >gb|KKY23993.1| putative epl1 protein [Diplodia seriata] Length = 139 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH A GFN+AQ AM++LTNNQA ALGRI+ + + +C L Sbjct: 89 GKTINVLAIDHAANGFNLAQAAMNDLTNNQAAALGRIEATSAEVPLSNCGL 139 >gb|KIL93997.1| hypothetical protein FAVG1_02559 [Fusarium avenaceum] Length = 138 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH A GFN++ AM+ LTNNQAV LGR+D AT+ ++C L Sbjct: 88 GKSINVLAIDHTAAGFNISPAAMNALTNNQAVKLGRVDATATQVPVKNCGL 138 >ref|XP_011325136.1| hypothetical protein FGSG_11205 [Fusarium graminearum PH-1] gi|558867431|gb|ESU17514.1| hypothetical protein FGSG_11205 [Fusarium graminearum PH-1] gi|596542453|gb|EYB22898.1| hypothetical protein FG05_11205 [Fusarium graminearum] gi|699036774|emb|CEF88414.1| unnamed protein product [Fusarium graminearum] Length = 140 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH A GFN++ AM+ LTNNQAV LGR+D AT+ +C L Sbjct: 88 GKSINVLAIDHTAAGFNISPAAMNALTNNQAVQLGRVDATATQVAVSNCGL 138 >ref|XP_007840857.1| Protein SnodProt1 [Pestalotiopsis fici W106-1] gi|573054260|gb|ETS74219.1| Protein SnodProt1 [Pestalotiopsis fici W106-1] Length = 138 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH A GFN+A AM+ LTN QAVALGR+D AT+ +C L Sbjct: 88 GKTINVLAIDHAAAGFNIALDAMNALTNGQAVALGRVDATATQVAVSNCGL 138 >ref|XP_007853231.1| allergenic cerato-platanin asp f13 [Moniliophthora roreri MCA 2997] gi|496208902|gb|AGL40525.1| cerato-platanin 3 [Moniliophthora roreri] gi|554905372|gb|ESK87458.1| allergenic cerato-platanin asp f13 [Moniliophthora roreri MCA 2997] Length = 135 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 ++ TGK + ++ +D GFNV QKAMD+LTN QAVALG IDV AT+ C L Sbjct: 81 WSGTGKTIHVVGVDVAGNGFNVGQKAMDDLTNGQAVALGNIDVTATRVDKSVCGL 135 >gb|EGU82724.1| hypothetical protein FOXB_06779 [Fusarium oxysporum Fo5176] gi|477510793|gb|ENH63703.1| Protein SnodProt1 [Fusarium oxysporum f. sp. cubense race 1] gi|587659835|gb|EWY82203.1| hypothetical protein FOYG_14319 [Fusarium oxysporum FOSC 3-a] gi|587708443|gb|EWZ79780.1| hypothetical protein FOWG_16107 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587739125|gb|EXA36841.1| hypothetical protein FOVG_12723 [Fusarium oxysporum f. sp. pisi HDV247] gi|590034682|gb|EXK36540.1| hypothetical protein FOMG_09713 [Fusarium oxysporum f. sp. melonis 26406] gi|590059035|gb|EXK86559.1| hypothetical protein FOQG_09827 [Fusarium oxysporum f. sp. raphani 54005] gi|591417369|gb|EXL52506.1| hypothetical protein FOCG_08297 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591440044|gb|EXL72722.1| hypothetical protein FOPG_11776 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591491767|gb|EXM21390.1| hypothetical protein FOTG_10912 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 139 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH A GFN++ AM+ LTNNQAV LGR+D AT+ +C L Sbjct: 88 GKSINVLAIDHTAAGFNISPAAMNALTNNQAVKLGRVDATATQVAISNCGL 138 >gb|KFY44746.1| hypothetical protein V494_01337 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 138 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK + +LAIDH GFN+AQ A+D LTNNQAV LGRID +AT+ + C + Sbjct: 88 GKSINVLAIDHADAGFNIAQGALDALTNNQAVQLGRIDAQATQIDAKLCGM 138 >ref|XP_007853235.1| allergenic cerato-platanin asp f13 [Moniliophthora roreri MCA 2997] gi|496208953|gb|AGL40528.1| cerato-platanin 8 [Moniliophthora roreri] gi|554905376|gb|ESK87462.1| allergenic cerato-platanin asp f13 [Moniliophthora roreri MCA 2997] Length = 135 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +2 Query: 2 YAKTGKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 ++ TGK + ++ +D GFNV QKAMD+LTN QAVALG IDV AT+ C L Sbjct: 81 WSGTGKTIHVVGVDVAGNGFNVGQKAMDDLTNGQAVALGNIDVTATQVDKSVCGL 135 >gb|EMD92796.1| hypothetical protein COCHEDRAFT_1202737 [Bipolaris maydis C5] gi|477587735|gb|ENI04816.1| hypothetical protein COCC4DRAFT_50890 [Bipolaris maydis ATCC 48331] Length = 138 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = +2 Query: 14 GKKVFILAIDHVAQGFNVAQKAMDELTNNQAVALGRIDVKATKARWQDCSL 166 GK +++LAIDH GFN+AQ AM++LTN QA ALGRID + + +C L Sbjct: 88 GKTIYVLAIDHTGAGFNIAQAAMNQLTNGQAAALGRIDAQYQQVAVSNCGL 138