BLASTX nr result
ID: Forsythia21_contig00049418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049418 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069897.1| PREDICTED: xyloglucan endotransglucosylase/h... 87 3e-15 ref|XP_011069898.1| PREDICTED: xyloglucan endotransglucosylase/h... 81 2e-13 gb|EYU20917.1| hypothetical protein MIMGU_mgv1a009848mg [Erythra... 72 1e-10 gb|EPS61624.1| hypothetical protein M569_13171 [Genlisea aurea] 70 4e-10 ref|XP_011079308.1| PREDICTED: xyloglucan endotransglucosylase/h... 68 3e-09 ref|XP_012831306.1| PREDICTED: probable xyloglucan endotransgluc... 64 3e-08 ref|XP_006366190.1| PREDICTED: probable xyloglucan endotransgluc... 59 2e-06 ref|XP_004243015.1| PREDICTED: probable xyloglucan endotransgluc... 59 2e-06 >ref|XP_011069897.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 24-like isoform X1 [Sesamum indicum] Length = 333 Score = 87.4 bits (215), Expect = 3e-15 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = -1 Query: 177 NPNQSRSNS-FIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVEIVTSAPTIVIGNGTF 4 NP Q RS+ F+PYL FIIF AIFVFKVD+IISQTI ARRNVE +TS PT+VIGNGTF Sbjct: 14 NPQQPRSHKLFLPYLGFIIFSAIFVFKVDVIISQTISVARRNVETITSRPTVVIGNGTF 72 >ref|XP_011069898.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 24-like isoform X2 [Sesamum indicum] Length = 332 Score = 81.3 bits (199), Expect = 2e-13 Identities = 43/59 (72%), Positives = 48/59 (81%), Gaps = 1/59 (1%) Frame = -1 Query: 177 NPNQSRSNS-FIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVEIVTSAPTIVIGNGTF 4 NP Q RS+ F+PYL FIIF AIFVFKVD+IISQTI ARRNVE +T PT+VIGNGTF Sbjct: 14 NPQQPRSHKLFLPYLGFIIFSAIFVFKVDVIISQTISVARRNVETIT-RPTVVIGNGTF 71 >gb|EYU20917.1| hypothetical protein MIMGU_mgv1a009848mg [Erythranthe guttata] Length = 329 Score = 72.0 bits (175), Expect = 1e-10 Identities = 38/70 (54%), Positives = 48/70 (68%), Gaps = 7/70 (10%) Frame = -1 Query: 189 MPP-RNPNQSRSNSFIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVEIVTSAPTIVI-- 19 MPP RN +Q RS+ F+PYL FI+F AIFVFK+D++ISQTI +ARR E + S P I Sbjct: 1 MPPIRNSHQPRSSKFVPYLGFIVFSAIFVFKLDVLISQTISTARRTQETIISNPNITTRP 60 Query: 18 ----GNGTFH 1 NGTF+ Sbjct: 61 KPEDENGTFY 70 >gb|EPS61624.1| hypothetical protein M569_13171 [Genlisea aurea] Length = 201 Score = 70.5 bits (171), Expect = 4e-10 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 10/73 (13%) Frame = -1 Query: 189 MPPRNPNQSRS---NSFIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVEIVTSA----- 34 MPPRN +Q ++ N F+PY AFIIF AIFVFK+D+IISQ I SAR E +T+A Sbjct: 1 MPPRNNSQQQAAPPNKFLPYFAFIIFSAIFVFKLDLIISQNILSARPYRETITTAREIQL 60 Query: 33 --PTIVIGNGTFH 1 P +I NGTF+ Sbjct: 61 PTPPAIIENGTFN 73 >ref|XP_011079308.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 22-like [Sesamum indicum] Length = 330 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 8/71 (11%) Frame = -1 Query: 189 MPPRNPNQSRSNSFIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVEI-------VTSAP 31 MPPR+ +Q R+ ++IPY+AFIIF AIFVF++D+ ++QTI +ARRN E+ S P Sbjct: 1 MPPRSSHQPRAGTYIPYMAFIIFSAIFVFRLDVFVTQTISTARRNQELKYEITTQEPSPP 60 Query: 30 TIVIG-NGTFH 1 T++ N TF+ Sbjct: 61 TVIKNENATFY 71 >ref|XP_012831306.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25 [Erythranthe guttatus] gi|604343544|gb|EYU42433.1| hypothetical protein MIMGU_mgv1a009847mg [Erythranthe guttata] Length = 329 Score = 64.3 bits (155), Expect = 3e-08 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = -1 Query: 192 VMPPRNPNQS--RSNSFIPYLAFIIFCAIFVFKVDIIISQTIFSA--RRNVEIVTSAPTI 25 +M RN + S RS+ F+PYLAFI+F AIFVFKVDIIISQTI A N ++P + Sbjct: 3 IMNQRNSSHSSSRSHKFLPYLAFILFSAIFVFKVDIIISQTISGAPSYNNYLDSLTSPNL 62 Query: 24 VIGNGTFH 1 GNGTF+ Sbjct: 63 RFGNGTFY 70 >ref|XP_006366190.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25-like [Solanum tuberosum] Length = 342 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 17/73 (23%) Frame = -1 Query: 171 NQSRSNSFIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVE-----------------IV 43 N SRS S +PYL F++ A FVFKVDI+ISQ+ SARRN+E +V Sbjct: 8 NSSRSRSSLPYLVFLLIAAFFVFKVDILISQSFSSARRNLEKTPNRIVVNPKKSSEERVV 67 Query: 42 TSAPTIVIGNGTF 4 S P +++ NGTF Sbjct: 68 DSLPVVLV-NGTF 79 >ref|XP_004243015.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25 [Solanum lycopersicum] Length = 342 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 17/73 (23%) Frame = -1 Query: 171 NQSRSNSFIPYLAFIIFCAIFVFKVDIIISQTIFSARRNVE-----------------IV 43 N SRS S +PYL F++ A FVFKVDI+ISQ+ SARRN+E +V Sbjct: 8 NSSRSRSSLPYLVFLLIAAFFVFKVDILISQSFSSARRNLEKTPNRIVVNPQKSSEERVV 67 Query: 42 TSAPTIVIGNGTF 4 S P +++ NGTF Sbjct: 68 DSLPVVLV-NGTF 79