BLASTX nr result
ID: Forsythia21_contig00049314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049314 (566 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 72 2e-10 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 WKARGYSRRRFSILNVSNSKPNMKLWFHSAPLWK 104 WKA+GYSRRRFS L+VSNSKPNMKLWFHSAPLW+ Sbjct: 24 WKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57