BLASTX nr result
ID: Forsythia21_contig00049254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049254 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850145.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 65 2e-08 ref|XP_011087726.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 63 7e-08 ref|XP_010028503.1| PREDICTED: armadillo repeat-containing prote... 62 2e-07 gb|KCW55239.1| hypothetical protein EUGRSUZ_I01172 [Eucalyptus g... 62 2e-07 gb|KCW55238.1| hypothetical protein EUGRSUZ_I01172 [Eucalyptus g... 62 2e-07 ref|XP_010447172.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 60 6e-07 gb|KDO49135.1| hypothetical protein CISIN_1g031404mg [Citrus sin... 60 6e-07 ref|NP_567943.1| RING/U-box domain-containing protein [Arabidops... 60 6e-07 ref|XP_006480137.1| PREDICTED: armadillo repeat-containing prote... 60 6e-07 ref|XP_006423067.1| hypothetical protein CICLE_v10029827mg, part... 60 6e-07 dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] 60 6e-07 ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arab... 60 6e-07 emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|72703... 60 6e-07 gb|AAM62531.1| unknown [Arabidopsis thaliana] 60 6e-07 gb|KJB79275.1| hypothetical protein B456_013G041100 [Gossypium r... 59 1e-06 ref|XP_012464865.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 59 1e-06 gb|KJB79273.1| hypothetical protein B456_013G041100 [Gossypium r... 59 1e-06 ref|XP_010530880.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 59 1e-06 ref|XP_010530879.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 59 1e-06 gb|KHF98114.1| RING finger protein [Gossypium arboreum] 59 1e-06 >ref|XP_012850145.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Erythranthe guttatus] gi|604313187|gb|EYU26518.1| hypothetical protein MIMGU_mgv1a011883mg [Erythranthe guttata] Length = 267 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 5/41 (12%) Frame = -1 Query: 111 EDGIGKEDGFN-----IDDVCPICFDRFTIPCRTNCGHWYC 4 E+GI K G+N +DDVCPICFDRF+IPCR+NCGHW+C Sbjct: 63 EEGI-KGGGYNKEKAPVDDVCPICFDRFSIPCRSNCGHWFC 102 >ref|XP_011087726.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Sesamum indicum] Length = 265 Score = 63.2 bits (152), Expect = 7e-08 Identities = 35/93 (37%), Positives = 49/93 (52%), Gaps = 10/93 (10%) Frame = -1 Query: 252 ILDRKRNSLQEIEMGSENLDRTRTHQEIXXXXXXXXXXXXXXXXXIAEDGIGKE-----D 88 ++ RK + E++M ++ L R H E+ + +GI +E Sbjct: 14 LVSRKAHQEMEMKMENDILCGKRFHPEMEDDNSNDEEEHVGGG---SGNGIEEEIDDRVG 70 Query: 87 GFN-----IDDVCPICFDRFTIPCRTNCGHWYC 4 GFN +DDVCPICFDRF IPCR+NCGHW+C Sbjct: 71 GFNKDIPPVDDVCPICFDRFIIPCRSNCGHWFC 103 >ref|XP_010028503.1| PREDICTED: armadillo repeat-containing protein 6 [Eucalyptus grandis] Length = 665 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 99 GKEDGFNIDDVCPICFDRFTIPCRTNCGHWYCG 1 GK+D DDVCPICF FT+PC+T CGHWYCG Sbjct: 18 GKQDSPPDDDVCPICFGDFTVPCKTVCGHWYCG 50 >gb|KCW55239.1| hypothetical protein EUGRSUZ_I01172 [Eucalyptus grandis] Length = 160 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 99 GKEDGFNIDDVCPICFDRFTIPCRTNCGHWYCG 1 GK+D DDVCPICF FT+PC+T CGHWYCG Sbjct: 18 GKQDSPPDDDVCPICFGDFTVPCKTVCGHWYCG 50 >gb|KCW55238.1| hypothetical protein EUGRSUZ_I01172 [Eucalyptus grandis] Length = 211 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 99 GKEDGFNIDDVCPICFDRFTIPCRTNCGHWYCG 1 GK+D DDVCPICF FT+PC+T CGHWYCG Sbjct: 18 GKQDSPPDDDVCPICFGDFTVPCKTVCGHWYCG 50 >ref|XP_010447172.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Camelina sativa] Length = 249 Score = 60.1 bits (144), Expect = 6e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD+CPICF FT+PCR NCGHWYCG Sbjct: 56 DDICPICFSSFTVPCRGNCGHWYCG 80 >gb|KDO49135.1| hypothetical protein CISIN_1g031404mg [Citrus sinensis] Length = 160 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -1 Query: 108 DGIGKEDGFNIDDVCPICFDRFTIPCRTNCGHWYC 4 + I +DG +DD CPICF FTIPC+ NCGHWYC Sbjct: 19 ESIEGKDGPPVDDCCPICFGDFTIPCKANCGHWYC 53 >ref|NP_567943.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|63003762|gb|AAY25410.1| At4g33940 [Arabidopsis thaliana] gi|87116618|gb|ABD19673.1| At4g33940 [Arabidopsis thaliana] gi|332660897|gb|AEE86297.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 262 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DDVCPICF FT+PCR NCGHWYCG Sbjct: 71 DDVCPICFGSFTVPCRGNCGHWYCG 95 >ref|XP_006480137.1| PREDICTED: armadillo repeat-containing protein 6-like [Citrus sinensis] Length = 669 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -1 Query: 108 DGIGKEDGFNIDDVCPICFDRFTIPCRTNCGHWYC 4 + I +DG +DD CPICF FTIPC+ NCGHWYC Sbjct: 19 ESIEGKDGPPVDDCCPICFGDFTIPCKANCGHWYC 53 >ref|XP_006423067.1| hypothetical protein CICLE_v10029827mg, partial [Citrus clementina] gi|557525001|gb|ESR36307.1| hypothetical protein CICLE_v10029827mg, partial [Citrus clementina] Length = 314 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -1 Query: 108 DGIGKEDGFNIDDVCPICFDRFTIPCRTNCGHWYC 4 + I +DG +DD CPICF FTIPC+ NCGHWYC Sbjct: 121 ESIEGKDGPPVDDCCPICFGDFTIPCKANCGHWYC 155 >dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] Length = 252 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DDVCPICF FT+PCR NCGHWYCG Sbjct: 61 DDVCPICFGSFTVPCRGNCGHWYCG 85 >ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] gi|297315020|gb|EFH45443.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] Length = 683 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DDVCPICF FT+PCR NCGHWYCG Sbjct: 71 DDVCPICFGSFTVPCRGNCGHWYCG 95 >emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|7270343|emb|CAB80111.1| putative protein [Arabidopsis thaliana] Length = 670 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DDVCPICF FT+PCR NCGHWYCG Sbjct: 71 DDVCPICFGSFTVPCRGNCGHWYCG 95 >gb|AAM62531.1| unknown [Arabidopsis thaliana] Length = 262 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DDVCPICF FT+PCR NCGHWYCG Sbjct: 71 DDVCPICFGSFTVPCRGNCGHWYCG 95 >gb|KJB79275.1| hypothetical protein B456_013G041100 [Gossypium raimondii] Length = 169 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FT+PCR+NCGHWYCG Sbjct: 26 DDCCPICFGSFTVPCRSNCGHWYCG 50 >ref|XP_012464865.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Gossypium raimondii] gi|763812422|gb|KJB79274.1| hypothetical protein B456_013G041100 [Gossypium raimondii] Length = 216 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FT+PCR+NCGHWYCG Sbjct: 26 DDCCPICFGSFTVPCRSNCGHWYCG 50 >gb|KJB79273.1| hypothetical protein B456_013G041100 [Gossypium raimondii] Length = 179 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FT+PCR+NCGHWYCG Sbjct: 26 DDCCPICFGSFTVPCRSNCGHWYCG 50 >ref|XP_010530880.1| PREDICTED: E3 ubiquitin-protein ligase RNF170 isoform X2 [Tarenaya hassleriana] Length = 249 Score = 59.3 bits (142), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FTIPCR NCGHWYCG Sbjct: 64 DDCCPICFGSFTIPCRANCGHWYCG 88 >ref|XP_010530879.1| PREDICTED: E3 ubiquitin-protein ligase RNF170 isoform X1 [Tarenaya hassleriana] Length = 250 Score = 59.3 bits (142), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FTIPCR NCGHWYCG Sbjct: 64 DDCCPICFGSFTIPCRANCGHWYCG 88 >gb|KHF98114.1| RING finger protein [Gossypium arboreum] Length = 213 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 75 DDVCPICFDRFTIPCRTNCGHWYCG 1 DD CPICF FT+PCR+NCGHWYCG Sbjct: 26 DDCCPICFGSFTVPCRSNCGHWYCG 50