BLASTX nr result
ID: Forsythia21_contig00049146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049146 (374 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011026533.1| PREDICTED: uncharacterized protein LOC105127... 47 5e-07 ref|XP_007013730.1| Enhancer of polycomb-like transcription fact... 47 5e-06 ref|XP_007013727.1| Enhancer of polycomb-like transcription fact... 47 5e-06 ref|XP_007013729.1| Enhancer of polycomb-like transcription fact... 47 5e-06 ref|XP_007013731.1| Enhancer of polycomb-like transcription fact... 47 5e-06 ref|XP_002516604.1| hypothetical protein RCOM_0804080 [Ricinus c... 47 6e-06 >ref|XP_011026533.1| PREDICTED: uncharacterized protein LOC105127107 [Populus euphratica] Length = 1726 Score = 47.4 bits (111), Expect(2) = 5e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDI 157 NLELL+C A VL T G+KGWRECG +VVL++ Sbjct: 1197 NLELLSCDANVLITNGDKGWRECGVQVVLEL 1227 Score = 32.7 bits (73), Expect(2) = 5e-07 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSSTSESGVASLRC 224 PFGG+D+S ++ Y Q +EKR SD R SE + L C Sbjct: 1156 PFGGFDYSPRNKGYQQKGFPHKRIRTATEKRTSDISRG--SERNLELLSC 1203 >ref|XP_007013730.1| Enhancer of polycomb-like transcription factor protein, putative isoform 4 [Theobroma cacao] gi|508784093|gb|EOY31349.1| Enhancer of polycomb-like transcription factor protein, putative isoform 4 [Theobroma cacao] Length = 1721 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDI 157 NLELL+C A +L T+G++GWRECGA+V L++ Sbjct: 1169 NLELLSCDANLLITLGDRGWRECGAQVALEL 1199 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSS 257 PFGG D+S+K+ ++Q +EKR SD R S Sbjct: 1128 PFGGLDYSSKNKGHHQRGPPHKRIRRANEKRSSDVSRGS 1166 >ref|XP_007013727.1| Enhancer of polycomb-like transcription factor protein, putative isoform 1 [Theobroma cacao] gi|590579224|ref|XP_007013728.1| Enhancer of polycomb-like transcription factor protein, putative isoform 1 [Theobroma cacao] gi|508784090|gb|EOY31346.1| Enhancer of polycomb-like transcription factor protein, putative isoform 1 [Theobroma cacao] gi|508784091|gb|EOY31347.1| Enhancer of polycomb-like transcription factor protein, putative isoform 1 [Theobroma cacao] Length = 1693 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDI 157 NLELL+C A +L T+G++GWRECGA+V L++ Sbjct: 1169 NLELLSCDANLLITLGDRGWRECGAQVALEL 1199 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSS 257 PFGG D+S+K+ ++Q +EKR SD R S Sbjct: 1128 PFGGLDYSSKNKGHHQRGPPHKRIRRANEKRSSDVSRGS 1166 >ref|XP_007013729.1| Enhancer of polycomb-like transcription factor protein, putative isoform 3 [Theobroma cacao] gi|508784092|gb|EOY31348.1| Enhancer of polycomb-like transcription factor protein, putative isoform 3 [Theobroma cacao] Length = 1674 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDI 157 NLELL+C A +L T+G++GWRECGA+V L++ Sbjct: 1150 NLELLSCDANLLITLGDRGWRECGAQVALEL 1180 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSS 257 PFGG D+S+K+ ++Q +EKR SD R S Sbjct: 1109 PFGGLDYSSKNKGHHQRGPPHKRIRRANEKRSSDVSRGS 1147 >ref|XP_007013731.1| Enhancer of polycomb-like transcription factor protein, putative isoform 5 [Theobroma cacao] gi|508784094|gb|EOY31350.1| Enhancer of polycomb-like transcription factor protein, putative isoform 5 [Theobroma cacao] Length = 1522 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDI 157 NLELL+C A +L T+G++GWRECGA+V L++ Sbjct: 1169 NLELLSCDANLLITLGDRGWRECGAQVALEL 1199 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSS 257 PFGG D+S+K+ ++Q +EKR SD R S Sbjct: 1128 PFGGLDYSSKNKGHHQRGPPHKRIRRANEKRSSDVSRGS 1166 >ref|XP_002516604.1| hypothetical protein RCOM_0804080 [Ricinus communis] gi|223544424|gb|EEF45945.1| hypothetical protein RCOM_0804080 [Ricinus communis] Length = 1705 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 249 NLELLACGAYVLGTVGNKGWRECGARVVLDIS 154 NLELL+C A VL T+G+KGWRE GA+VVL++S Sbjct: 1181 NLELLSCEANVLITLGDKGWREYGAQVVLELS 1212 Score = 28.9 bits (63), Expect(2) = 6e-06 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -2 Query: 373 PFGGYDFSTKHNIYNQXXXXXXXXXXXSEKRVSDFPRSSTSESGVASLRC 224 PFG +D+S+K ++Q +EKR SD R SE + L C Sbjct: 1140 PFGAFDYSSKSKGHSQKGIPHKRIRTANEKRSSDVSRG--SERNLELLSC 1187